Recombinant Full Length Listeria Innocua Serovar 6A Cardiolipin Synthase(Cls) Protein, His-Tagged
Cat.No. : | RFL31520LF |
Product Overview : | Recombinant Full Length Listeria innocua serovar 6a Cardiolipin synthase(cls) Protein (Q927Z0) (1-482aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Listeria innocua serovar 6a |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-482) |
Form : | Lyophilized powder |
AA Sequence : | MGLLAYLLVILLILNVFFAAVTVFLERRDTSATWAWLLVLTFVPIFGFIIYLIFGRKLSG KKIFDWKGQEKIGIQESTANQIEMIRQKEFPFSDPNVKKHRDLIYLLLVNDGAILTQDNE VELFIDGHEKFDALIADIEKAKDHIHLIYYIFHSDELGNRLMRVLERKAAEGLNVKIIYD AMGSRTTKKSFFRTFEKNGGLVRPFFPSKLPLINFRLNYRNHRKLAIIDGDVGYIGGFNI GDEYLGRSKKFGYWRDTHLRVHGKAVYAMQTRFIMDWNSASSTHKIDYKARYFPTFHGKG HTSMQIVSSGPDSEWQQIKNGYIKMINAAKKTIYLQSPYFIPDASLLEAIKIAALSGVDV RVMIPNKPDHAFVYRATTNYAGELMETGAKIFIYDNGFIHAKTLVVDGEIASVGTANMDF RSFRLNFEVNAFIYEKKMVQKLEDAFLEDILKSYQLTPELYAKRSLWIKFKEAVSRLLSP IL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cls |
Synonyms | cls; lin2646; Cardiolipin synthase; CL synthase |
UniProt ID | Q927Z0 |
◆ Recombinant Proteins | ||
JAM2-817H | Recombinant Human JAM2 | +Inquiry |
TSHB-497C | Recombinant Chicken TSHB Protein, His-tagged | +Inquiry |
INO80-4447C | Recombinant Chicken INO80 | +Inquiry |
MORF4L2-5361H | Recombinant Human MORF4L2 Protein (Met1-Leu288), C-His tagged | +Inquiry |
T04B8.5-3175Z | Recombinant Zebrafish T04B8.5 | +Inquiry |
◆ Native Proteins | ||
Lectin-1867W | Active Native Succinylated Wheat Germ Agglutinin Protein | +Inquiry |
ALB-115C | Native Chicken Serum Albumin | +Inquiry |
NFL-01P | Native Pig NFL Protein (549 AA) | +Inquiry |
ApoA-I-3554H | Native Human ApoA-I | +Inquiry |
IgA-240B | Native Bovine Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLIPR1L2-5903HCL | Recombinant Human GLIPR1L2 293 Cell Lysate | +Inquiry |
HIST1H2BB-5542HCL | Recombinant Human HIST1H2BB 293 Cell Lysate | +Inquiry |
UFSP1-518HCL | Recombinant Human UFSP1 293 Cell Lysate | +Inquiry |
FAM65B-6359HCL | Recombinant Human FAM65B 293 Cell Lysate | +Inquiry |
SLCO1A2-1690HCL | Recombinant Human SLCO1A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All cls Products
Required fields are marked with *
My Review for All cls Products
Required fields are marked with *
0
Inquiry Basket