Recombinant Full Length Esx-3 Secretion System Protein Eccb3(Eccb3) Protein, His-Tagged
Cat.No. : | RFL3554HF |
Product Overview : | Recombinant Full Length ESX-3 secretion system protein eccB3(eccB3) Protein (O53688) (1-538aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-538) |
Form : | Lyophilized powder |
AA Sequence : | MTNQQHDHDFDHDRRSFASRTPVNNNPDKVVYRRGFVTRHQVTGWRFVMRRIAAGIALHD TRMLVDPLRTQSRAVLMGVLIVITGLIGSFVFSLIRPNGQAGSNAVLADRSTAALYVRVG EQLHPVLNLTSARLIVGRPVSPTTVKSTELDQFPRGNLIGIPGAPERMVQNTSTDANWTV CDGLNAPSRGGADGVGVTVIAGPLEDTGARAAALGPGQAVLVDSGAGTWLLWDGKRSPID LADHAVTSGLGLGADVPAPRIIASGLFNAIPEAPPLTAPIIPDAGNPASFGVPAPIGAVV SSYALKDSGKTISDTVQYYAVLPDGLQQISPVLAAILRNNNSYGLQQPPRLGADEVAKLP VSRVLDTRRYPSEPVSLVDVTRDPVTCAYWSKPVGAATSSLTLLAGSALPVPDAVHTVEL VGAGNGGVATRVALAAGTGYFTQTVGGGPDAPGAGSLFWVSDTGVRYGIDNEPQGVAGGG KAVEALGLNPPPVPIPWSVLSLFVPGPTLSRADALLAHDTLVPDSRPARPVSAEGGYR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ESX-3 secretion system protein eccB3(eccB3) |
UniProt ID | O53688 |
◆ Recombinant Proteins | ||
LRRC18-4682H | Recombinant Human LRRC18 Protein, GST-tagged | +Inquiry |
SNX11-1449H | Recombinant Human SNX11 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CXCL12-306H | Recombinant Human CXCL12 protein | +Inquiry |
DIABLOB-8032Z | Recombinant Zebrafish DIABLOB | +Inquiry |
GCA-5164HF | Recombinant Full Length Human GCA Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
HP-7761R | Native Rabbit Haptoglobin Protein | +Inquiry |
Actin-340R | Native Rabbit Actin Protein | +Inquiry |
ELN-01H | Active Native Human ELN Protein | +Inquiry |
SERPINC1-8032H | Native Human Plasma AntiThromblin III | +Inquiry |
TcdB-189C | Active Native Clostridium difficile Toxin B Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CMTM1-371HCL | Recombinant Human CMTM1 cell lysate | +Inquiry |
C18orf1-215HCL | Recombinant Human C18orf1 cell lysate | +Inquiry |
USP14-471HCL | Recombinant Human USP14 293 Cell Lysate | +Inquiry |
STAU1-1415HCL | Recombinant Human STAU1 293 Cell Lysate | +Inquiry |
KDR-417HCL | Recombinant Human KDR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ESX-3 secretion system protein eccB3(eccB3) Products
Required fields are marked with *
My Review for All ESX-3 secretion system protein eccB3(eccB3) Products
Required fields are marked with *
0
Inquiry Basket