Recombinant Human LRRC18 Protein, GST-tagged

Cat.No. : LRRC18-4682H
Product Overview : Human LRRC18 full-length ORF ( NP_001006940.2, 1 a.a. - 261 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : LRRC18 (Leucine Rich Repeat Containing 18) is a Protein Coding gene. Diseases associated with LRRC18 include Usher Syndrome, Type Ik and Deafness, Autosomal Recessive 33. An important paralog of this gene is PIDD1.
Molecular Mass : 56.1 kDa
AA Sequence : MVKGEKGPKGKKITLKVARNCIKITFDGKKRLDLSKMGITTFPKCILRLSDMDELDLSRNLIRKIPDSISKFQNLRWLDLHSNYIDKLPESIGQMTSLLYLNVSNNRLTSNGLPVELKQLKNIRAVNLGLNHLDSVSTTLGALKELHEVGLHDNLLNNIPVSISKLPKLKKLNIKRNPFPKPGESEIFIDSIRRLENLYVVEEKDLCAACLRKCQNARDNLNRIKNMATTTPRKTIFPNLISPNSMAKDSWEDWRIRLTSS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LRRC18 leucine rich repeat containing 18 [ Homo sapiens ]
Official Symbol LRRC18
Synonyms UNQ933; UNQ9338; VKGE9338; LRRC18; leucine rich repeat containing 18
Gene ID 474354
mRNA Refseq NM_001006939
Protein Refseq NP_001006940
UniProt ID Q8N456

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LRRC18 Products

Required fields are marked with *

My Review for All LRRC18 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon