Recombinant Human CXCL12 protein
Cat.No. : | CXCL12-306H |
Product Overview : | Recombinant Human CXCL12 beta protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 72 |
Description : | CXCL12 also known as SDF-1 is belonging to the CXC chemokine family. It is encoded by the CXCL12 gene. In recently study, Human CXCL12 is expressed as six isoforms that differ only in the C-terminal tail. And all SDF-1 isoforms undergo proteolytic processing of the first two N-terminal amino acids. In all SDF-1 isoforms, SDF-1β is the canonical sequence. It has the complete amino acids in the C-terminal tail. On the cell surface, the receptor for this chemokine is CXCR4 and syndecan4. CXCL12 is strongly chemotactic for T-lymphocytes, monocytes, but not neutrophils. CXCL12 is a very important factor in carcinogenesis and the neovascularisation linked to tumor progression. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using PHA and rHuIL-2 activated human peripheral blood T-lymphocytes is in a concentration range of 20-80 ng/ml. |
Molecular Mass : | Approximately 8.5 kDa, a single non-glycosylated polypeptide chain containing 72 amino acid residues. |
AA Sequence : | KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM |
Endotoxin : | Less than 1 EU/μg of rHuSDF-1β/CXCL12β as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | CXCL12 |
Official Symbol | CXCL12 |
Synonyms | CXCL12; chemokine (C-X-C motif) ligand 12; SDF1, SDF1A, SDF1B, stromal cell derived factor 1; stromal cell-derived factor 1; PBSF; SCYB12; SDF 1a; SDF 1b; TLSF a; TLSF b; TPAR1; intercrine reduced in hepatomas; pre-B cell growth-stimulating factor; IRH; SDF1; TLSF; SDF1A; SDF1B; |
Gene ID | 6387 |
mRNA Refseq | NM_000609 |
Protein Refseq | NP_000600 |
MIM | 600835 |
UniProt ID | P48061 |
◆ Recombinant Proteins | ||
CXCL12-6079C | Recombinant Chicken CXCL12 | +Inquiry |
CXCL12-629H | Recombinant Human CXCL12 protein(Lys22-Lys89) | +Inquiry |
Cxcl12-208C | Active Recombinant Mouse Cxcl12 Protein (68 aa) | +Inquiry |
CXCL12-192H | Recombinant Human CXCL12 Protein, DYKDDDDK-tagged | +Inquiry |
CXCL12-64H | Recombinant Human Stromal Cell-Dreived Factor 1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL12-3016HCL | Recombinant Human CXCL12 cell lysate | +Inquiry |
CXCL12-1863CCL | Recombinant Cynomolgus CXCL12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CXCL12 Products
Required fields are marked with *
My Review for All CXCL12 Products
Required fields are marked with *
0
Inquiry Basket