Recombinant Human CXCL12 protein

Description :	CXCL12 also known as SDF-1 is belonging to the CXC chemokine family. It is encoded by the CXCL12 gene. In recently study, Human CXCL12 is expressed as six isoforms that differ only in the C-terminal tail. And all SDF-1 isoforms undergo proteolytic processing of the first two N-terminal amino acids. In all SDF-1 isoforms, SDF-1β is the canonical sequence. It has the complete amino acids in the C-terminal tail. On the cell surface, the receptor for this chemokine is CXCR4 and syndecan4. CXCL12 is strongly chemotactic for T-lymphocytes, monocytes, but not neutrophils. CXCL12 is a very important factor in carcinogenesis and the neovascularisation linked to tumor progression.
Source :	E.coli
Species :	Human
Form :	Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity :	Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using PHA and rHuIL-2 activated human peripheral blood T-lymphocytes is in a concentration range of 20-80 ng/ml.
Molecular Mass :	Approximately 8.5 kDa, a single non-glycosylated polypeptide chain containing 72 amino acid residues.
Protein length :	72
AA Sequence :	KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
Endotoxin :	Less than 1 EU/μg of rHuSDF-1β/CXCL12β as determined by LAL method.
Purity :	>97% by SDS-PAGE and HPLC analysis.
Storage :	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution :	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Tag :	Non

Gene Name	CXCL12
Official Symbol	CXCL12
Synonyms	CXCL12; chemokine (C-X-C motif) ligand 12; SDF1, SDF1A, SDF1B, stromal cell derived factor 1; stromal cell-derived factor 1; PBSF; SCYB12; SDF 1a; SDF 1b; TLSF a; TLSF b; TPAR1; intercrine reduced in hepatomas; pre-B cell growth-stimulating factor; IRH; SDF1; TLSF; SDF1A; SDF1B;
Gene ID	6387
mRNA Refseq	NM_000609
Protein Refseq	NP_000600
MIM	600835
UniProt ID	P48061