Recombinant Full Length Escherichia Coli Bifunctional Protein Aas(Aas) Protein, His-Tagged
Cat.No. : | RFL4653EF |
Product Overview : | Recombinant Full Length Escherichia coli Bifunctional protein aas(aas) Protein (B1XDP2) (1-719aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-719) |
Form : | Lyophilized powder |
AA Sequence : | MLFSFFRNLCRVLYRVRVTGDTQALKGERVLITPNHVSFIDGILLGLFLPVRPVFAVYTS ISQQWYMRWLKSFIDFVPLDPTQPMAIKHLVRLVEQGRPVVIFPEGRITTTGSLMKIYDG AGFVAAKSGATVIPVRIEGAELTHFSRLKGLVKRRLFPQITLHILPPTQVAMPDAPRARD RRKIAGEMLHQIMMEARMAVRPRETLYESLLSAMYRFGAGKKCVEDVNFTPDSYRKLLTK TLFVGRILEKYSVEGERIGLMLPNAGISAAVIFGAIARRRMPAMMNYTAGVKGLTSAITA AEIKTIFTSRQFLDKGKLWHLPEQLTQVRWVYLEDLKADVTTADKVWIFAHLLMPRLAQV KQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFTTNDRFMSALPLFHSFG LTVGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVPMAAKPGTVGRILPGM DARLLSVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERGWYDTGDIVR FDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGEALVLFT TDNELTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGKPDFVTLKSWVDEAEQHDE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | aas |
Synonyms | aas; ECDH10B_3006; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; |
UniProt ID | B1XDP2 |
◆ Recombinant Proteins | ||
SSX2-2109H | Recombinant Human SSX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NSL1-260H | Recombinant Human NSL1, MIS12 kinetochore complex component, His-tagged | +Inquiry |
WNT5A-118H | Active Recombinant Human WNT5A Protein | +Inquiry |
RFL20523EF | Recombinant Full Length Escherichia Coli Tyrosine-Protein Kinase Etk(Etk) Protein, His-Tagged | +Inquiry |
CCDC42-0550H | Recombinant Human CCDC42 Protein, GST-Tagged | +Inquiry |
◆ Native Proteins | ||
IgA2-211H | Native Human Immunoglobulin A2 (IgA2) | +Inquiry |
GPT-188S | Active Native Swine Glutamate Pyruvate Transaminase | +Inquiry |
ACTC1-885B | Native Bovine ACTC1 Protein, Pyrene labeled | +Inquiry |
C4-195H | Native Human Complement C4c | +Inquiry |
IgG4-232H | Native Human Immunoglobulin G4 (IgG4) | +Inquiry |
◆ Cell & Tissue Lysates | ||
Esophagus-640B | Bovine Esophagus Lysate, Total Protein | +Inquiry |
PLDN-3120HCL | Recombinant Human PLDN 293 Cell Lysate | +Inquiry |
CDX4-7601HCL | Recombinant Human CDX4 293 Cell Lysate | +Inquiry |
CCBP2-7795HCL | Recombinant Human CCBP2 293 Cell Lysate | +Inquiry |
ADD2-9015HCL | Recombinant Human ADD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All aas Products
Required fields are marked with *
My Review for All aas Products
Required fields are marked with *
0
Inquiry Basket