Recombinant Full Length Salmonella Heidelberg Bifunctional Protein Aas(Aas) Protein, His-Tagged
Cat.No. : | RFL17568SF |
Product Overview : | Recombinant Full Length Salmonella heidelberg Bifunctional protein aas(aas) Protein (B4TGR5) (1-719aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella Heidelberg |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-719) |
Form : | Lyophilized powder |
AA Sequence : | MLFGFFRNLFRVLYRVRVTGDVRALQGNRVLITPNHVSFIDGMLLALFLPVRPVFAVYTS ISQQWYMRWLTPLIDFVPLDPTKPMSIKHLVRLVEQGRPVVIFPEGRISVTGSLMKIYDG AGFVAAKSGATVIPLRIDGAELTPFSRLKGLVKRRLFPRIQLHILPPTQIPMPEAPRARD RRKIAGEMLHQIMMEARMAVRPRETLYESLLAAQYRYGAGKNCIEDINFTPDTYRKLLTK TLFVGRILEKYSVEGEKIGLMLPNAAISAAVIFGAVSRRRIPAMMNYTAGVKGLTSAITA AEIKTIFTSRQFLDKGKLWHLPEQLTQVRWVYLEDLKADVTPADKLWIFAHLLAPRLAQV KQQPEDAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFTANDRFMSALPLFHSFG LTVGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRNCTVLFGTSTFLGNYARFANPYDFYR LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVPMAAKPGTVGRILPGM DARLLAVPGIENGGRLQLKGPNIMNGYLRVEKPGVLEVPSAENARGETERGWYDTGDIVR FDENGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSADKMHATAIKSDASKGEALVLFT TDSELTREKLQHYAREHGIPELAVPRDIRYLKQLPLLGSGKPDFVTLKSWVDAPEQHHE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | aas |
Synonyms | aas; SeHA_C3223; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; Lo |
UniProt ID | B4TGR5 |
◆ Recombinant Proteins | ||
PREB-749Z | Recombinant Zebrafish PREB | +Inquiry |
LIPG-16H | Recombinant Human LIPG Protein, His-tagged | +Inquiry |
GLI1-1254H | Recombinant Human GLI1 Protein (921-1106 aa), His-tagged | +Inquiry |
RPLD-2969S | Recombinant Staphylococcus epidermidis ATCC 12228 RPLD protein, His-tagged | +Inquiry |
Col6a1-345M | Recombinant Mouse Col6a1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
PROC-64H | Active Native Human Activated Protein C | +Inquiry |
IgG-342R | Native RABBIT IgG | +Inquiry |
F10-5395R | Active Native Rat Coagulation Factor X | +Inquiry |
PLAU-22H | Native Human PLAU protein | +Inquiry |
Lectin-1838S | Active Native Sambucus Nigra Lectin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBM41-2469HCL | Recombinant Human RBM41 293 Cell Lysate | +Inquiry |
RPN2-2182HCL | Recombinant Human RPN2 293 Cell Lysate | +Inquiry |
Duodenum-672H | Hamster Duodenum Lysate, Total Protein | +Inquiry |
NUP62CL-1234HCL | Recombinant Human NUP62CL cell lysate | +Inquiry |
ATP2C1-148HCL | Recombinant Human ATP2C1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All aas Products
Required fields are marked with *
My Review for All aas Products
Required fields are marked with *
0
Inquiry Basket