Recombinant Full Length Escherichia Coli Bifunctional Protein Aas(Aas) Protein, His-Tagged
Cat.No. : | RFL24705EF |
Product Overview : | Recombinant Full Length Escherichia coli Bifunctional protein aas(aas) Protein (P31119) (1-719aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-719) |
Form : | Lyophilized powder |
AA Sequence : | MLFSFFRNLCRVLYRVRVTGDTQALKGERVLITPNHVSFIDGILLGLFLPVRPVFAVYTS ISQQWYMRWLKSFIDFVPLDPTQPMAIKHLVRLVEQGRPVVIFPEGRITTTGSLMKIYDG AGFVAAKSGATVIPVRIEGAELTHFSRLKGLVKRRLFPQITLHILPPTQVAMPDAPRARD RRKIAGEMLHQIMMEARMAVRPRETLYESLLSAMYRFGAGKKCVEDVNFTPDSYRKLLTK TLFVGRILEKYSVEGERIGLMLPNAGISAAVIFGAIARRRMPAMMNYTAGVKGLTSAITA AEIKTIFTSRQFLDKGKLWHLPEQLTQVRWVYLEDLKADVTTADKVWIFAHLLMPRLAQV KQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFTTNDRFMSALPLFHSFG LTVGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVPMAAKPGTVGRILPGM DARLLSVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERGWYDTGDIVR FDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGEALVLFT TDNELTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGKPDFVTLKSWVDEAEQHDE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | aas |
Synonyms | aas; b2836; JW2804; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; |
UniProt ID | P31119 |
◆ Recombinant Proteins | ||
PHKG2-0210H | Recombinant Human PHKG2 Protein (T2-G406), Tag Free | +Inquiry |
KRTAP12-4-2449R | Recombinant Rhesus monkey KRTAP12-4 Protein, His-tagged | +Inquiry |
CCL11-1155R | Active Recombinant Rhesus Monkey CCL11 Protein | +Inquiry |
MT1X-130H | Recombinant Human MT1X Protein, His-tagged | +Inquiry |
MTHFD2L-3469R | Recombinant Rat MTHFD2L Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
S100A7-3195H | Native Human S100A7 protein(Met1-Gln101) | +Inquiry |
ALA-02B | Native Bovine α-Lactalbumin Protein | +Inquiry |
FG-164B | Native Bovine fibrinogen degradation products | +Inquiry |
IgG-333T | Native Turkey IgG | +Inquiry |
Thrombin-12S | Native Atlantic salmon Thrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP1R12A-2947HCL | Recombinant Human PPP1R12A 293 Cell Lysate | +Inquiry |
DEF8-6992HCL | Recombinant Human DEF8 293 Cell Lysate | +Inquiry |
FAM46D-265HCL | Recombinant Human FAM46D lysate | +Inquiry |
KCNK7-5031HCL | Recombinant Human KCNK7 293 Cell Lysate | +Inquiry |
STAT1-555HCL | Recombinant Human STAT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All aas Products
Required fields are marked with *
My Review for All aas Products
Required fields are marked with *
0
Inquiry Basket