Recombinant Full Length Salmonella Typhimurium Bifunctional Protein Aas(Aas) Protein, His-Tagged
Cat.No. : | RFL36964SF |
Product Overview : | Recombinant Full Length Salmonella typhimurium Bifunctional protein aas(aas) Protein (Q8ZMA4) (1-719aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhimurium |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-719) |
Form : | Lyophilized powder |
AA Sequence : | MLFGFFRNLFRVLYRVRVTGDVRALQGNRVLITPNHVSFIDGMLLALFLPVRPVFAVYTS ISQQWYMRWLTPLIDFVPLDPTKPMSIKHLVRLVEQGRPVVIFPEGRISVTGSLMKIYDG AGFVAAKSGATVIPLRIDGAELTPFSRLKGLVKRRLFPRIQLHILPPTQIPMPEAPRARD RRKIAGEMLHQIMMEARMAVRPRETLYESLLAAQYRYGAGKNCIEDINFTPDTYRKLLTK TLFVGRILEKYSVEGEKIGLMLPNAAISAAVIFGAVSRRRIPAMMNYTAGVKGLTSAITA AEIKTIFTSRQFLDKGKLWHLPEQLTQVRWVYLEDLKADVTPADKLWIFAHLLAPRLAQV KQQPEDAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFTANDRFMSALPLFHSFG LTVGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRNCTVLFGTSTFLGNYARFANPYDFYR LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVPMAAKPGTVGRILPGM DARLLAVPGIENGGRLQLKGPNIMNGYLRVEKPGVLEVPSAENSRGETERGWYDTGDIVR FDENGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSADKMHATAIKSDASKGEALVLFT TDSELTREKLQHYAREHGIPELAVPRDIRYLKQLPLLGSGKPDFVTLKSWVDAPEQHHE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | aas |
Synonyms | aas; STM3010; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; Long- |
UniProt ID | Q8ZMA4 |
◆ Recombinant Proteins | ||
DLTC-1168B | Recombinant Bacillus subtilis DLTC protein, His-tagged | +Inquiry |
SAOUHSC-02108-1321S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 SAOUHSC_02108 protein, His-tagged | +Inquiry |
MEN1-30096TH | Recombinant Human MEN1 | +Inquiry |
Denr-2526M | Recombinant Mouse Denr Protein, Myc/DDK-tagged | +Inquiry |
FOS-27240TH | Recombinant Human FOS, His-tagged | +Inquiry |
◆ Native Proteins | ||
Sphingomyelinase-38S | Active Native Staphylococcus aureus Sphingomyelinase | +Inquiry |
Lectin-1831R | Active Native Ricinus Communis Agglutinin I Protein, Biotinylated | +Inquiry |
Angiostatin-28H | Active Native Human Angiostatin K1-4 | +Inquiry |
Collagen-315B | Native Bovine Collagen Type III | +Inquiry |
Immunoglobulin A2-78H | Native Human Immunoglobulin A2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
Testis-148R | Rat Testis Tissue Lysate | +Inquiry |
IMPA1-5214HCL | Recombinant Human IMPA1 293 Cell Lysate | +Inquiry |
CAMKV-605HCL | Recombinant Human CAMKV cell lysate | +Inquiry |
OSBPL2-3538HCL | Recombinant Human OSBPL2 293 Cell Lysate | +Inquiry |
ERGIC1-6558HCL | Recombinant Human ERGIC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All aas Products
Required fields are marked with *
My Review for All aas Products
Required fields are marked with *
0
Inquiry Basket