Recombinant Full Length Escherichia Coli Bifunctional Protein Aas(Aas) Protein, His-Tagged
Cat.No. : | RFL3937EF |
Product Overview : | Recombinant Full Length Escherichia coli Bifunctional protein aas(aas) Protein (B1LR34) (1-719aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-719) |
Form : | Lyophilized powder |
AA Sequence : | MLFSFFRNLCRVLYRVRVTGDTQALKGERVLITPNHVSFIDGILLALFLPVRPVFAVYTS ISQQWYMRWLKSFIDFVPLDPTQPMAIKHLVRLVEQGRPVVIFPEGRITTTGSLMKIYDG AGFVAAKSGATVIPVRIEGAELTHFSRLKGLVKRRLFPQITLHILPPTQVEMPDAPRARD RRKIAGEMLHQIMMEARMAVRPRETLYESLLSAMYRFGAGKKCVEDVNFTPDSYRKLLTK TLFVGRILEKYSVEGEHIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITA AEIKTIFTSRQFLDKGKLWHLPEQLTQVRWVYLEDLKADVTTADKVWIFAHLLMPRLAQV KQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFTTNDRFMSALPLFHSFG LTVGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVPMAAKPGTVGRILPGM DARLLSVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERGWYDTGDIVR FDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGEALVLFT TDNELTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGKPDFVTLKSWVDEAEQHDE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | aas |
Synonyms | aas; EcSMS35_2984; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; |
UniProt ID | B1LR34 |
◆ Recombinant Proteins | ||
TCTEX1D2-16593M | Recombinant Mouse TCTEX1D2 Protein | +Inquiry |
RFL27874VF | Recombinant Full Length Vaccinia Virus Protein E8 (Vacwr064) Protein, His-Tagged | +Inquiry |
LSR-4850H | Recombinant Human LSR Protein (Met431-Ser540), N-His tagged | +Inquiry |
RFL14500VF | Recombinant Full Length Varicella-Zoster Virus Glycoprotein N(Gn) Protein, His-Tagged | +Inquiry |
CLECL1P-02H | Recombinant Human CLECL1P Protein, N-His-tagged | +Inquiry |
◆ Native Proteins | ||
F13A1-28806TH | Native Human F13A1 | +Inquiry |
H3N2-02I | Active Native IAV H3N2 Protein | +Inquiry |
ALPI-5B | Active Native Bovine Alkaline Phosphatase | +Inquiry |
FSH-185H | Active Native Human Follicle Stimulating Hormone(FSH) protein | +Inquiry |
Pertussis-37 | Native Pertussis Toxin Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
Epididymis-8H | Human Adult Epididymis Membrane Lysate | +Inquiry |
ELK1-520HCL | Recombinant Human ELK1 cell lysate | +Inquiry |
EPHB6-1319CCL | Recombinant Cynomolgus EPHB6 cell lysate | +Inquiry |
Umbilical Cord-11H | Human Fetal Umbilical Cord Membrane Lysate | +Inquiry |
TKTL1-1053HCL | Recombinant Human TKTL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All aas Products
Required fields are marked with *
My Review for All aas Products
Required fields are marked with *
0
Inquiry Basket