Recombinant Full Length Escherichia Coli Bifunctional Protein Aas(Aas) Protein, His-Tagged
Cat.No. : | RFL28308EF |
Product Overview : | Recombinant Full Length Escherichia coli Bifunctional protein aas(aas) Protein (C4ZZY9) (1-719aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-719) |
Form : | Lyophilized powder |
AA Sequence : | MLFSFFRNLCRVLYRVRVTGDTQALKGERVLITPNHVSFIDGILLGLFLPVRPVFAVYTS ISQQWYMRWLKSFIDFVPLDPTQPMAIKHLVRLVEQGRPVVIFPEGRITTTGSLMKIYDG AGFVAAKSGATVIPVRIEGAELTHFSRLKGLVKRRLFPQITLHILPPTQVAMPDAPRARD RRKIAGEMLHQIMMEARMAVRPRETLYESLLSAMYRFGAGKKCVEDVNFTPDSYRKLLTK TLFVGRILEKYSVEGERIGLMLPNAGISAAVIFGAIARRRMPAMMNYTAGVKGLTSAITA AEIKTIFTSRQFLDKGKLWHLPEQLTQVRWVYLEDLKADVTTADKVWIFAHLLMPRLAQV KQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFTTNDRFMSALPLFHSFG LTVGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVPMAAKPGTVGRILPGM DARLLSVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERGWYDTGDIVR FDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGEALVLFT TDNELTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGKPDFVTLKSWVDEAEQHDE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | aas |
Synonyms | aas; BWG_2572; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; Long |
UniProt ID | C4ZZY9 |
◆ Recombinant Proteins | ||
GC-4268H | Recombinant HHV-1(strain KOS) GC protein, His-KSI-tagged | +Inquiry |
XIAP-246H | Recombinant Human XIAP Protein, His/StrepII-tagged | +Inquiry |
NEU1-3005R | Recombinant Rhesus monkey NEU1 Protein, His-tagged | +Inquiry |
SPACA3-2892H | Recombinant Human SPACA3 protein, His-tagged | +Inquiry |
EPFL9-4868M | Recombinant Mouse-ear cress EPFL9 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgA-243C | Native Cat Immunoglobulin A | +Inquiry |
GOT1-5351H | Native Human Glutamic-Oxaloacetic Transaminase 1, Soluble (aspartate aminotransferase 1) | +Inquiry |
CAPN1-186p | Active Native porcine Calpain-1 | +Inquiry |
TI-50S | Active Native Soybean Trypsin Inhibitor | +Inquiry |
CTSL1-1859H | Native Human Cathepsin L1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANPEP-3000MCL | Recombinant Mouse ANPEP cell lysate | +Inquiry |
DZIP3-6744HCL | Recombinant Human DZIP3 293 Cell Lysate | +Inquiry |
KCNG3-5062HCL | Recombinant Human KCNG3 293 Cell Lysate | +Inquiry |
YBEY-8099HCL | Recombinant Human C21orf57 293 Cell Lysate | +Inquiry |
RBM12-2480HCL | Recombinant Human RBM12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All aas Products
Required fields are marked with *
My Review for All aas Products
Required fields are marked with *
0
Inquiry Basket