Recombinant Full Length Yersinia Pestis Bv. Antiqua Bifunctional Protein Aas(Aas) Protein, His-Tagged
Cat.No. : | RFL23669YF |
Product Overview : | Recombinant Full Length Yersinia pestis bv. Antiqua Bifunctional protein aas(aas) Protein (Q1CAS8) (1-718aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yersinia pestis bv. Antiqua |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-718) |
Form : | Lyophilized powder |
AA Sequence : | MAYRLLRALFRGLFRVTIDGVTDQFKHEKLIITPNHVSFLDGALLALFLPIKPVFAVYTS ITDTWYMRWLKPYVDFVALDPTNPMAIKHLVRMVEQGRPVVIFPEGRITVTGSLMKIYDG AAFVAAKSGAAVVPIRLDGPEFTHFGRLQGVLKTRWFPKISIHVLPATTIPMPQAPRSRE RRVLAGEHLHTIMMAARMATVPRETLFEALLSAQTRYGRFKPCIEDVSFKEDSYQTLLKK TLGVSRILQRFTVPGEHVGMLLPNATITAAAIFGASLRGRIPALLNYTSGAKGLQSAIIA ASLKTIVTSRQFLEKGKLTHLPEQVNEVNWVYLEDLKDTVTLTDKLWILFHLCFPRRAML PQQADGSALILFTSGSEGNPKGVVHSHASLLANVEQIRTIADFTPRDRFMSSLPLFHAFG LTVGLFTPLMTGSRVFLYPSPLHYRVVPELVYDRNCTVLFGTSTFLGNYARFAHPYDFAR VRYVVAGAEKLAESTKQIWQDKFGIRILEGYGVTECAPVVAINVPMAAKVNTVGRILPGM EARLINVPGIAQGGRLQLRGPNIMRGYLRVENPGVLEQPSAENAQGELDANWYDTGDIVT LDEQGFCAIRGRVKRFAKLAGEMVSLESVEQLAISLSPEGQHAAAAKTDSAKGEALVLFT TDSEITRERLIKVARENGVPELAVPRDIRVVKALPLLGSGKPDFVTLGKMAQDPEMSV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | aas |
Synonyms | aas; YPA_0476; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; Long |
UniProt ID | Q1CAS8 |
◆ Recombinant Proteins | ||
NR3C1-28739TH | Recombinant Human NR3C1, His-tagged | +Inquiry |
EXOSC3-4355C | Recombinant Chicken EXOSC3 | +Inquiry |
GPX1-7230M | Recombinant Mouse GPX1 Protein | +Inquiry |
ARMC2-1947M | Recombinant Mouse ARMC2 Protein | +Inquiry |
MLLT11-228H | Recombinant Human MLLT11, His-tagged | +Inquiry |
◆ Native Proteins | ||
A1AGP-01P | Native Porcine A1AGP Protein | +Inquiry |
H3N2993-216I | Native H3N2 (A/Shandong/9/93) H3N2993 protein | +Inquiry |
TNC-50H | Native Human Tenascin C | +Inquiry |
Lectin-1783G | Native Griffonia Simplicifolia Lectin I isolectin B4 Protein, DyLight 594 Labeled | +Inquiry |
IgG-154R | Native Rabbit Immunoglobulin G | +Inquiry |
◆ Cell & Tissue Lysates | ||
KRT19-4875HCL | Recombinant Human KRT19 293 Cell Lysate | +Inquiry |
CTSF-420HCL | Recombinant Human CTSF cell lysate | +Inquiry |
LSM11-4611HCL | Recombinant Human LSM11 293 Cell Lysate | +Inquiry |
RAB24-2617HCL | Recombinant Human RAB24 293 Cell Lysate | +Inquiry |
C11orf49-8348HCL | Recombinant Human C11orf49 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All aas Products
Required fields are marked with *
My Review for All aas Products
Required fields are marked with *
0
Inquiry Basket