Recombinant Full Length Salmonella Newport Bifunctional Protein Aas(Aas) Protein, His-Tagged
Cat.No. : | RFL36849SF |
Product Overview : | Recombinant Full Length Salmonella newport Bifunctional protein aas(aas) Protein (B4T503) (1-719aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella newport |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-719) |
Form : | Lyophilized powder |
AA Sequence : | MLFGFFRNLFRVLYRVRVTGDVRVLQGNRVLITPNHVSFIDGMLLALFLPVRPVFAVYTS ISQQWYMRWLTPLIDFVPLDPTKPMSIKHLVRLVEQGRPVVIFPEGRISVTGSLMKIYDG AGFVAAKSGATVIPLRIDGAELTPFSRLKGLVKRRLFPRIQLHILPSTQIPMPEAPRARD RRKIAGEMLHQIMMEARMAVRPRETLYESLLAAQYRYGAGKNCIEDINFTPDTYRKLLTK TLFVGRILEKYSVEGEKIGLMLPNAAISAAVIFGAVSRRRIPAMMNYTAGVKGLTSAITA AEIKTIFTSRQFLDKGKLWHLPEQLTQVRWVYLEDLKADVTPADKLWIFAHLLAPRLAQV KQQPEDAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFTANDRFMSALPLFHSFG LTVGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRNCTVLFGTSTFLGNYARFANPYDFYR LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVPMAAKPGTVGRILPGM DARLLAVPGIENGGRLQLKGPNIMNGYLRVEKPGVLEVPSAENSRGETERGWYDTGDIVR FDENGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSADKMHATAIKSDASKGEALVLFT TDSELTREKLQHYAREHGIPELAVPRDIRYLKQLPLLGSGKPDFVTLKSWVDAPEQHHE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | aas |
Synonyms | aas; SNSL254_A3238; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; |
UniProt ID | B4T503 |
◆ Recombinant Proteins | ||
DGKA-181H | Active Recombinant Human DGKA protein, GST-tagged | +Inquiry |
TGL-1664G | Recombinant Geobacillus thermocatenulatus TGL Protein (Full Length), N-His tagged | +Inquiry |
FANCD2-1926R | Recombinant Rat FANCD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ACTRT2-273C | Recombinant Cynomolgus ACTRT2 Protein, His-tagged | +Inquiry |
PPIF-1101H | Active Recombinant Human Peptidylprolyl Isomerase F, His-tagged | +Inquiry |
◆ Native Proteins | ||
HRP-8336h | Active Native horseradish HRP | +Inquiry |
LDL-396H | Native Human Low Density Lipoprotein, DiI labeled | +Inquiry |
toxB-11C | Native C. difficile toxB | +Inquiry |
CHC-001C | Native Clostridium Histolyticum Collagenase, Tag Free | +Inquiry |
Plg-32M | Native Mouse Plg protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOXO1-6149HCL | Recombinant Human FOXO1 293 Cell Lysate | +Inquiry |
SCIN-1568HCL | Recombinant Human SCIN cell lysate | +Inquiry |
STK36-1714HCL | Recombinant Human STK36 cell lysate | +Inquiry |
OXCT1-3508HCL | Recombinant Human OXCT1 293 Cell Lysate | +Inquiry |
LIG4-4746HCL | Recombinant Human LIG4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All aas Products
Required fields are marked with *
My Review for All aas Products
Required fields are marked with *
0
Inquiry Basket