Recombinant Full Length Escherichia Coli Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL18795EF |
Product Overview : | Recombinant Full Length Escherichia coli Apolipoprotein N-acyltransferase(lnt) Protein (P23930) (1-512aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-512) |
Form : | Lyophilized powder |
AA Sequence : | MAFASLIERQRIRLLLALLFGACGTLAFSPYDVWPAAIISLMGLQALTFNRRPLQSAAIG FCWGFGLFGSGINWVYVSIATFGGMPGPVNIFLVVLLAAYLSLYTGLFAGVLSRLWPKTT WLRVAIAAPALWQVTEFLRGWVLTGFPWLQFGYSQIDGPLKGLAPIMGVEAINFLLMMVS GLLALALVKRNWRPLVVAVVLFALPFPLRYIQWFTPQPEKTIQVSMVQGDIPQSLKWDEG QLLNTLKIYYNATAPLMGKSSLIIWPESAITDLEINQQPFLKALDGELRDKGSSLVTGIV DARLNKQNRYDTYNTIITLGKGAPYSYESADRYNKNHLVPFGEFVPLESILRPLAPFFDL PMSSFSRGPYIQPPLSANGIELTAAICYEIILGEQVRDNFRPDTDYLLTISNDAWFGKSI GPWQHFQMARMRALELARPLLRSTNNGITAVIGPQGEIQAMIPQFTREVLTTNVTPTTGL TPYARTGNWPLWVLTALFGFAAVLMSLRQRRK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; cutE; b0657; JW0654; Apolipoprotein N-acyltransferase; ALP N-acyltransferase; Copper homeostasis protein CutE |
UniProt ID | P23930 |
◆ Recombinant Proteins | ||
ARIH2-800H | Recombinant Human ARIH2 protein, GST-tagged | +Inquiry |
PNCK-4204R | Recombinant Rat PNCK Protein, His (Fc)-Avi-tagged | +Inquiry |
ISCS-2219B | Recombinant Bacillus subtilis ISCS protein, His-tagged | +Inquiry |
LILRA3-311H | Recombinant Human LILRA3, His tagged | +Inquiry |
WHSC1-18545M | Recombinant Mouse WHSC1 Protein | +Inquiry |
◆ Native Proteins | ||
APOC3-669H | Native Human APOC3 protein | +Inquiry |
BSI-B4-851 | Active Native Bandeiraea simplicifolia Isolectin B4 protein, biotin-conjugated | +Inquiry |
ALOD-36 | Active Native Alcohol oxidase | +Inquiry |
PMPCB-284H | Native Human PMPCB, DDK-tagged | +Inquiry |
HBA2-27787TH | Native Human HBA2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRPSAP1-2819HCL | Recombinant Human PRPSAP1 293 Cell Lysate | +Inquiry |
ZCCHC3-1964HCL | Recombinant Human ZCCHC3 cell lysate | +Inquiry |
MFSD2A-1086HCL | Recombinant Human MFSD2A cell lysate | +Inquiry |
Persimmon-704P | Persimmon Lysate, Total Protein | +Inquiry |
CD97-2207HCL | Recombinant Human CD97 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket