Recombinant Full Length Coxiella Burnetii Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL18988CF |
Product Overview : | Recombinant Full Length Coxiella burnetii Apolipoprotein N-acyltransferase(lnt) Protein (Q820B4) (1-485aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Coxiella Burnetii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-485) |
Form : | Lyophilized powder |
AA Sequence : | MNSVLALIAGAILPLAFAPFNWFPIAFVSPAILLAVWLRSRPLVAWWRGWLFGFGFFGAG ASWVYVSIHHFGNANVPLAVLITVLFVFVLALFIAFQGLSFSLFFRKRKAALTALFAFPA WWVVWEWLRSILFTGFPWLFLGYSQINSPLKGFGPLFGIYGISLIVAFISGCIYLLVTSK KLNKKIMCLILIILPFIVGWVLTFIPWTRPGSESVRVGLVQGNIGQRLKWDPDTLYSTLH TYYSETQKNWDHGIIVWPEAAIPIYPQQVSVFLQALDKEAKQHNTALMTGIPIYHEKTNK VFNGLMVLGDGHGLYLKRHLVPFGESFTSSKICNLLMKYFDIPMSDLSPGPEDQEPTVVK GIPFAPFICYEIAYPTEVLNHLSNKQFIVVVNDDSWFAGTIAPAQQLQIAQMRALETERY LLYSTNTGITAIISPEGKIVKSAPQNQRLLLTGQIKPVTGKTPLMRWNYYPVVGIIIIFL LLTFL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; CBU_0564; Apolipoprotein N-acyltransferase; ALP N-acyltransferase |
UniProt ID | Q820B4 |
◆ Recombinant Proteins | ||
ACVR1C-255H | Recombinant Human ACVR1C Protein, Fc-tagged | +Inquiry |
MRPL28-6435HF | Recombinant Full Length Human MRPL28 Protein, GST-tagged | +Inquiry |
TPX2-1921H | Recombinant Human TPX2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ASB7-1361HF | Recombinant Full Length Human ASB7 Protein, GST-tagged | +Inquiry |
SRF-2095H | Recombinant Human SRF Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
PLG-15H | Native Human Plasminogen Protein | +Inquiry |
C3-05M | Native Mouse C3 Protein | +Inquiry |
Lectin-1773E | Active Native Erythrina Cristagalli Lectin Protein, Biotinylated | +Inquiry |
ALOD-36 | Active Native Alcohol oxidase | +Inquiry |
FABP1-509H | Native Human FABP1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RER1-2419HCL | Recombinant Human RER1 293 Cell Lysate | +Inquiry |
BCAM-1708MCL | Recombinant Mouse BCAM cell lysate | +Inquiry |
AMY2A-1351HCL | Recombinant Human AMY2A cell lysate | +Inquiry |
IDH3G-5303HCL | Recombinant Human IDH3G 293 Cell Lysate | +Inquiry |
BRD4-179HCL | Recombinant Human BRD4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket