Recombinant Full Length Drosophila Melanogaster Putative Odorant Receptor 88A(Or88A) Protein, His-Tagged
Cat.No. : | RFL7844DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative odorant receptor 88a(Or88a) Protein (Q9VFN2) (1-401aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-401) |
Form : | Lyophilized powder |
AA Sequence : | MKPTEIKKPYRMEEFLRPQMFQEVAQMVHFQWRRNPVDNSMVNASMVPFCLSAFLNVLFF GCNGWDIIGHFWLGHPANQNPPVLSITIYFSIRGLMLYLKRKEIVEFVNDLDRECPRDLV SQLDMQMDETYRNFWQRYRFIRIYSHLGGPMFCVVPLALFLLTHEGKDTPVAQHEQLLGG WLPCGVRKDPNFYLLVWSFDLMCTTCGVSFFVTFDNLFNVMQGHLVMHLGHLARQFSAID PRQSLTDEKRFFVDLRLLVQRQQLLNGLCRKYNDIFKVAFLVSNFVGAGSLCFYLFMLSE TSDVLIIAQYILPTLVLVGFTFEICLRGTQLEKASEGLESSLRSQEWYLGSRRYRKFYLL WTQYCQRTQQLGAFGLIQVNMVHFTEIMQLAYRLFTFLKSH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Or88a |
Synonyms | Or88a; CG14360; Odorant receptor 88a |
UniProt ID | Q9VFN2 |
◆ Recombinant Proteins | ||
RFL24002SF | Recombinant Full Length Schizosaccharomyces Pombe Uncharacterized Protein C688.12C(Spac688.12C) Protein, His-Tagged | +Inquiry |
ASAH1-1020HF | Recombinant Full Length Human ASAH1 Protein, GST-tagged | +Inquiry |
PARL-394H | Recombinant Human PARL Full Length Transmembrane protein, Myc-tagged | +Inquiry |
DEFB20-2305M | Recombinant Mouse DEFB20 Protein, His (Fc)-Avi-tagged | +Inquiry |
IER5L-2992R | Recombinant Rat IER5L Protein | +Inquiry |
◆ Native Proteins | ||
APOE-5336H | Native Human Apolipoprotein E | +Inquiry |
THBS1-5524H | Natve Human Thrombospondin | +Inquiry |
LTA-18S | Native S. aureus LTA Protein | +Inquiry |
MMP2-46H | Native Human MMP-2 | +Inquiry |
VEGFA-31701TH | Native Human VEGFA | +Inquiry |
◆ Cell & Tissue Lysates | ||
PHLDA3-3219HCL | Recombinant Human PHLDA3 293 Cell Lysate | +Inquiry |
KRT81-958HCL | Recombinant Human KRT81 cell lysate | +Inquiry |
ZDHHC17-194HCL | Recombinant Human ZDHHC17 293 Cell Lysate | +Inquiry |
PARK7-3432HCL | Recombinant Human PARK7 293 Cell Lysate | +Inquiry |
HGS-783HCL | Recombinant Human HGS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Or88a Products
Required fields are marked with *
My Review for All Or88a Products
Required fields are marked with *
0
Inquiry Basket