Recombinant Human PARL Full Length Transmembrane protein, Myc-tagged

• Cat.No.: PARL-394H
• Product Overview: Recombinant Human PARL protein(Q9H300)(53-379aa), fused with C-terminal Myc tag, was expressed in in vitro E. coli expression system.

Specification

• Source: In vitro E. coli expression system
• Species: Human
• Tag: Myc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 37.8 kDa
• Protein length: 53-379aa
• AA Sequence: FRKAPRKVEPRRSDPGTSGEAYKRSALIPPVEETVFYPSPYPIRSLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQKEGDFRKEINKWWNNLSDGQRTVTGIIAANVLVFCLWRVPSLQRTMIRYFTSNPASKVLCSPMLLSTFSHFSLFHMAANMYVLWSFSSSIVNILGQEQFMAVYLSAGVISNFVSYVGKVATGRYGPSLGASGAIMTVLAAVCTKIPEGRLAIIFLPMFTFTAGNALKAIIAMDTAGMILGWKFFDHAAHLGGALFGIWYVTYGHELIWKNREPLVKIWHEIRTNGPKKGGGSK
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: PARL presenilin associated, rhomboid-like [ Homo sapiens ]
• Official Symbol: PARL
• Synonyms: PARL; presenilin associated, rhomboid-like; PSARL; presenilins-associated rhomboid-like protein, mitochondrial; PRO2207; PSARL1; RHBDS1; rhomboid 7 homolog 1 (Drosophila); rhomboid 7 homolog 1; mitochondrial intramembrane cleaving protease PARL; mitochondrial intramembrane-cleaving protease PARL; PSENIP2
• Gene ID: 55486
• mRNA Refseq: NM_001037639
• Protein Refseq: NP_001032728
• MIM: 607858
• UniProt ID: Q9H300