Recombinant Full Length Schizosaccharomyces Pombe Uncharacterized Protein C688.12C(Spac688.12C) Protein, His-Tagged
Cat.No. : | RFL24002SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Uncharacterized protein C688.12c(SPAC688.12c) Protein (Q9P6L4) (1-167aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-167) |
Form : | Lyophilized powder |
AA Sequence : | MSEEESPYQLTKTFSNPKNNKIGLAIFLIGAFINLIHIYKPKGPSNNPTKRNYHISFGPP GKIRWFPLGIRKEVRSNVSGREIIIKMIITFILVQTTLITLDLYVFGATGLGLILSWKLF EVACANPEDEALLAERKQRLKEQREKKEQKKEQKKEKKTERRKKKKL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPAC688.12c |
Synonyms | SPAC688.12c; Uncharacterized protein C688.12c |
UniProt ID | Q9P6L4 |
◆ Cell & Tissue Lysates | ||
CXorf40B-210HCL | Recombinant Human CXorf40B lysate | +Inquiry |
CSDA-409HCL | Recombinant Human CSDA cell lysate | +Inquiry |
CCDC134-1685HCL | Recombinant Human CCDC134 cell lysate | +Inquiry |
PDE6D-3345HCL | Recombinant Human PDE6D 293 Cell Lysate | +Inquiry |
AKAP10-44HCL | Recombinant Human AKAP10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPAC688.12c Products
Required fields are marked with *
My Review for All SPAC688.12c Products
Required fields are marked with *
0
Inquiry Basket