Recombinant Full Length Drosophila Melanogaster Putative Odorant Receptor 63A(Or63A) Protein, His-Tagged
Cat.No. : | RFL21254DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative odorant receptor 63a(Or63a) Protein (Q9VZW8) (1-420aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-420) |
Form : | Lyophilized powder |
AA Sequence : | MYSPEEAAELKRRNYRSIREMIRLSYTVGFNLLDPSRCGQVLRIWTIVLSVSSLASLYGH WQMLARYIHDIPRIGETAGTALQFLTSIAKMWYFLFAHRQIYELLRKARCHELLQKCELF ERMSDLPVIKEIRQQVESTMNRYWASTRRQILIYLYSCICITTNYFINSFVINLYRYFTK PKGSYDIMLPLPSLYPAWEHKGLEFPYYHIQMYLETCSLYICGMCAVSFDGVFIVLCLHS VGLMRSLNQMVEQATSELVPPDRRVEYLRCCIYQYQRVANFATEVNNCFRHITFTQFLLS LFNWGLALFQMSVGLGNNSSITMIRMTMYLVAAGYQIVVYCYNGQRFATASEEIANAFYQ VRWYGESREFRHLIRMMLMRTNRGFRLDVSWFMQMSLPTLMAMVRTSGQYFLLLQNVNQK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Or63a |
Synonyms | Or63a; CG9969; Odorant receptor 63a |
UniProt ID | Q9VZW8 |
◆ Recombinant Proteins | ||
RFL12689IF | Recombinant Full Length Influenza A Virus Matrix Protein 2(M) Protein, His-Tagged | +Inquiry |
LRP11-6013HF | Recombinant Full Length Human LRP11 Protein, GST-tagged | +Inquiry |
ABCG2-659H | Recombinant Human ABCG2 | +Inquiry |
PVRIG-231C | Recombinant Cynomolgus PVRIG protein, His-tagged | +Inquiry |
Erbb2-1896R | Recombinant Rat Erbb2 protein, His & GST-tagged | +Inquiry |
◆ Native Proteins | ||
Ovary-025H | Human Ovary Lysate, Total Protein | +Inquiry |
CA6-804H | Native Human CA6 | +Inquiry |
ApoA-II-3555H | Native Human ApoA-II | +Inquiry |
LDH1-16H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
CKMM-382H | Native Human Creatine Kinase MM (CK-MM) | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM222-963HCL | Recombinant Human TMEM222 293 Cell Lysate | +Inquiry |
MON1B-4255HCL | Recombinant Human MON1B 293 Cell Lysate | +Inquiry |
ROMO1-2252HCL | Recombinant Human ROMO1 293 Cell Lysate | +Inquiry |
HIST1H4J-5520HCL | Recombinant Human HIST1H4J 293 Cell Lysate | +Inquiry |
Stomach-477C | Cat Stomach Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Or63a Products
Required fields are marked with *
My Review for All Or63a Products
Required fields are marked with *
0
Inquiry Basket