Native Human CA6

• Cat.No.: CA6-804H
• Product Overview: Native Human CA6 was isolated from human milk.

Specification

• Species: Human
• Source: Human milk
• Tag: Non
• Description: Carbonic anhydrases (CAs) are enzymes which catalyze the reversible hydration of carbon dioxide according to the following reaction: CO2 + H2O ↔ HCO3- + H+. The main function of this protein family is to regulate the acid-base balance, which is of a considerable biological importance. In addition, they participate in several other physiological functions including CO2 and HCO3- transport, bone resorption, production of biological fluids, ureagenesis, gluconeogenesis and lipogenesis. Carbonic anhydrases are metalloenzymes containing a zinc-atom in their active site. The expanding CA gene family includes at least 13 enzymatically active members with different structural and catalytic properties.
  Purified by CA inhibitor affinity chromatography.
• Form: 0.1 M Tris-SO4 pH 7.0, 0.4 M NaN3, 1 mM Benzamidine and 20 % glycerol, pH 7.0
• Molecular Mass: 35 kDa
• Purity: > 95 % (SDS-PAGE under reducing conditions)
• Storage: Store at -80 centigrade, avoid freeze/thaw cycles.
• AA Sequence: MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEILDYLRRALN

Gene Information

• Gene Name: CA6 carbonic anhydrase VI [ Homo sapiens ]
• Official Symbol: CA6
• Synonyms: CA-VI; GUSTIN
• Gene ID: 765
• mRNA Refseq: NM_001215.3
• Protein Refseq: NP_001206.2
• MIM: 114780
• UniProt ID: P23280