Recombinant Full Length Drosophila Melanogaster Putative Gustatory Receptor 2A(Gr2A) Protein, His-Tagged
Cat.No. : | RFL24259DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative gustatory receptor 2a(Gr2a) Protein (Q9W594) (1-428aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-428) |
Form : | Lyophilized powder |
AA Sequence : | MDTLRALEPLHRACQVCNLWPWRLAPPPDSEGILLRRSRWLELYGWTVLIAATSFTVYGL FQESSVEEKQDSESTISSIGHTVDFIQLVGMRVAHLAALLEALWQRQAQRGFFAELGEID RLLSKALRVDVEAMRINMRRQTSRRAVWILWGYAVSQLLILGAKLLSRGDRFPIYWISYL LPLLVCGLRYFQIFNATQLVRQRLDVLLVALQQLQLHQKGPAVDTVLEEQEDLEEAAMDR LIAVRLVYQRVWALVALLNRCYGLSMLMQVGNDFLAITSNCYWMFLNFRQSAASPFDILQ IVASGVWSAPHLGNVLVLSLLCDRTAQCASRLALCLHQVSVDLRNESHNALVGTLVRYCA PLIILVPLQITQFSLQLLHQRLHFSAAGFFNVDCTLLYTIVGATTTYLIILIQFHMSEST IGSDSNGQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gr2a |
Synonyms | Gr2a; CG18531; Putative gustatory receptor 2a |
UniProt ID | Q9W594 |
◆ Native Proteins | ||
Lectin-1833R | Active Native Ricinus Communis Agglutinin I Protein | +Inquiry |
Luciferase-09F | Active Native Firefly Luciferase | +Inquiry |
F10-267B | Active Native Bovine Factor X | +Inquiry |
NEFH-181B | Native Bovine NEFH Protein | +Inquiry |
MYH-11R | Active Native Rabbit Myosin II Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDLIM1-3327HCL | Recombinant Human PDLIM1 293 Cell Lysate | +Inquiry |
TWIST1-1865HCL | Recombinant Human TWIST1 cell lysate | +Inquiry |
EFNA5-1574RCL | Recombinant Rat EFNA5 cell lysate | +Inquiry |
CACNG1-269HCL | Recombinant Human CACNG1 cell lysate | +Inquiry |
EXOC3-AS1-386HCL | Recombinant Human EXOC3-AS1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gr2a Products
Required fields are marked with *
My Review for All Gr2a Products
Required fields are marked with *
0
Inquiry Basket