Recombinant Human PRAP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PRAP1-4229H
• Product Overview: PRAP1 MS Standard C13 and N15-labeled recombinant protein (NP_660203) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: PRAP1 (Proline Rich Acidic Protein 1) is a Protein Coding gene. Diseases associated with PRAP1 include Hepatocellular Carcinoma. Among its related pathways are Autophagy - animal. An important paralog of this gene is ZNF511-PRAP1.
• Molecular Mass: 17.2 kDa
• AA Sequence: MRRLLLVTSLVVVLLWEAGAVPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLVVLFPVQKPKLLTTEEKPRGQGRGPILPGTKAWMETEDTLGRVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHPQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PRAP1 proline-rich acidic protein 1 [ Homo sapiens (human) ]
• Official Symbol: PRAP1
• Synonyms: PRAP1; proline-rich acidic protein 1; UPA; PRO1195; RP11-122K13.6; MGC126792
• Gene ID: 118471
• mRNA Refseq: NM_145202
• Protein Refseq: NP_660203
• MIM: 609776
• UniProt ID: Q96NZ9