Recombinant Human DECR1, His-tagged

Description :	This gene encodes an accessory enzyme which participates in the beta-oxidation and metabolism of unsaturated fatty enoyl-CoA esters.
Protein length :	301 amino acids
Conjugation :	HIS
Molecular Weight :	34.400kDa inclusive of tags
Source :	E. coli
Tissue specificity :	Heart = liver = pancreas >kidney >>skeletal muscle = lung.
Form :	Liquid
Purity :	>90% by SDS-PAGE
Storage buffer :	Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage :	Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids :	MGSSHHHHHHSSGLVPRGSHM NTEALQSKFFSPLQKAMLPPNSFQGKVAFITGGGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEELIRKTKGS
Sequence Similarities :	Belongs to the short-chain dehydrogenases/reductases (SDR) family. 2,4-dienoyl-CoA reductase subfamily.

Gene Name	DECR1 2,4-dienoyl CoA reductase 1, mitochondrial [ Homo sapiens ]
Official Symbol	DECR1
Synonyms	DECR1; 2,4-dienoyl CoA reductase 1, mitochondrial; DECR; 2,4-dienoyl-CoA reductase, mitochondrial; SDR18C1; short chain dehydrogenase/reductase family 18C; member 1;
Gene ID	1666
mRNA Refseq	NM_001359
Protein Refseq	NP_001350
Uniprot ID	Q16698
Chromosome Location	8q21.3
Pathway	Fatty Acid Beta Oxidation, organism-specific biosystem; Fatty Acid Biosynthesis, organism-specific biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Mitochondrial Fatty Acid Beta-Oxidation, organism-specific biosystem;
Function	2,4-dienoyl-CoA reductase (NADPH) activity; 2,4-dienoyl-CoA reductase (NADPH) activity; NADPH binding; nucleotide binding; oxidoreductase activity, acting on NADH or NADPH;