Recombinant Full Length Dictyostelium Discoideum Cln5-Like Protein 3(Cln5Lc) Protein, His-Tagged
Cat.No. : | RFL2151DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Cln5-like protein 3(cln5lc) Protein (Q54C37) (25-439aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (25-439) |
Form : | Lyophilized powder |
AA Sequence : | SDSGSSENGIYFYTYDTICEFTNSIRDDDQYELYYVQAPLMYAIYGDLFEKINAYHSGVG FYNLNGGPNISIDYFAGPTLEDALIPQNITKDSQGNYNLTWNTYGLIEVTNYINETYWSK RELIMYGLTGLQVKQYLSWAPIYNQTHPVYNLFSIASADASGSGDNGYLETILHNLGIGG GGGGSGSENLIVYQNSSTCDDFVWASFNTIYQLGGTLVGMQSNPPKDQITLFTTDEPTIV DYNNITQRNQLASFYINLMGIANKNESALQIFQELISLFNGTFYCYIDGVYYELHLSKPT PISFTYQPSPMPTGQRNSNSIETLNNCYSKSSTDNQSFFNRFSKIQIIFISIAIGFGVVI ILYISIGIMVNKSRGKSGTNLIPNKKLWTSIGSKFKRDNNKNNYKPLLYNENTIQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cln5lc |
Synonyms | cln5lc; DDB_G0293236; Cln5-like protein 3 |
UniProt ID | Q54C37 |
◆ Recombinant Proteins | ||
RFL24490RF | Recombinant Full Length Roseiflexus Sp. Ribonuclease Y(Rny) Protein, His-Tagged | +Inquiry |
VEGFC-108H | Active Recombinant Human VEGFC Protein | +Inquiry |
KIAA0930-3454H | Recombinant Human KIAA0930 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SLC25A20-926C | Recombinant Cynomolgus SLC25A20 Protein, His-tagged | +Inquiry |
AZIN1-3521H | Recombinant Human AZIN1, His-tagged | +Inquiry |
◆ Native Proteins | ||
Saporin-30S | Native Saponaria officinalis ribosome-inactivating Protein | +Inquiry |
Heart-005H | Human Heart Lysate, Total Protein | +Inquiry |
ALPL-66C | Active Native Calf Alkaline Phosphatase | +Inquiry |
IGHD -20H | Native Human IgD | +Inquiry |
Insulin-04B | Native Bovine Insulin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Mouse Embryo-152M | NIH/3T3 Whole Cell Lysate | +Inquiry |
RAPGEF5-1469HCL | Recombinant Human RAPGEF5 cell lysate | +Inquiry |
ZNF79-8HCL | Recombinant Human ZNF79 293 Cell Lysate | +Inquiry |
ZNF574-2059HCL | Recombinant Human ZNF574 cell lysate | +Inquiry |
RGS12-1501HCL | Recombinant Human RGS12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cln5lc Products
Required fields are marked with *
My Review for All cln5lc Products
Required fields are marked with *
0
Inquiry Basket