Recombinant Full Length Cuscuta Exaltata Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL7507CF |
Product Overview : | Recombinant Full Length Cuscuta exaltata Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (A8W3E7) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cuscuta exaltata (Tall dodder) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWGIAGGTVTNPGLWSYEGVAGAHIAFSGLCFLAAIWHWVYWDL EVFYDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP LKPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSE TWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVLLVDGDGIVRADVPFRRAESKYSVEQVGVTVAFYGGELNDVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTRRQAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | A8W3E7 |
◆ Recombinant Proteins | ||
RFL31962PF | Recombinant Full Length Leptosira Terrestris Atp Synthase Subunit B, Chloroplastic(Atpf) Protein, His-Tagged | +Inquiry |
FGF7-056H | Recombinant Human FGF7 Protein | +Inquiry |
PDE1B-2292H | Recombinant Human PDE1B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TREX1-2757H | Recombinant Human TREX1 Protein, His-MBP & His-tagged | +Inquiry |
ATOX1-26191TH | Recombinant Human ATOX1, His-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen Type I & III-06M | Native Mouse Collagen Type I and III Protein | +Inquiry |
Prothrombin-271B | Active Native Bovine Prothrombin Frag 1 | +Inquiry |
IGHE -22H | Native Human IgE | +Inquiry |
RB5200-3281H | Native Human RB5200 | +Inquiry |
Thrombin-31M | Active Native Mouse Thrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTPS2-7196HCL | Recombinant Human CTPS2 293 Cell Lysate | +Inquiry |
GOLPH3L-5832HCL | Recombinant Human GOLPH3L 293 Cell Lysate | +Inquiry |
PSMA3-511HCL | Recombinant Human PSMA3 lysate | +Inquiry |
NA-1743HCL | Recombinant H5N1 NA cell lysate | +Inquiry |
TNFSF9-2810MCL | Recombinant Mouse TNFSF9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket