Recombinant Full Length Lactuca Sativa Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL26668LF |
Product Overview : | Recombinant Full Length Lactuca sativa Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (Q332V1) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Lactuca sativa (Garden lettuce) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFSDERTGKPSLDLPKIFGIHLFLAGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQA VNPSWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPVTVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTRRQIG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | Q332V1 |
◆ Recombinant Proteins | ||
Gpt2-381M | Recombinant Mouse Gpt2 Protein, MYC/DDK-tagged | +Inquiry |
PPP1R9B-001H | Recombinant Human PPP1R9B Protein, His tagged | +Inquiry |
RFL69PF | Recombinant Full Length Pongo Abelii High Affinity Copper Uptake Protein 1(Slc31A1) Protein, His-Tagged | +Inquiry |
PSAT1-3062H | Recombinant Human PSAT1 Protein, MYC/DDK-tagged | +Inquiry |
il4/13a-4409A | Recombinant Atlantic Salmon il4/13a Protein | +Inquiry |
◆ Native Proteins | ||
TIMP1-92H | Native Human TIMP-1 | +Inquiry |
CVB6-14 | Native Coxsackievirus B6 Antigen | +Inquiry |
Plg-1897R | Native Rat Plasminogen | +Inquiry |
IgG-004B | Native Bovine Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
TSH-1315B | Active Native Bovine TSH Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPR157-741HCL | Recombinant Human GPR157 cell lysate | +Inquiry |
ZNF563-49HCL | Recombinant Human ZNF563 293 Cell Lysate | +Inquiry |
COX8A-194HCL | Recombinant Human COX8A lysate | +Inquiry |
PCSK4-1317HCL | Recombinant Human PCSK4 cell lysate | +Inquiry |
CLDN20-7465HCL | Recombinant Human CLDN20 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket