Recombinant Full Length Daucus Carota Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL26572DF |
Product Overview : | Recombinant Full Length Daucus carota Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (Q0G9T6) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Carrot |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLLAVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITSSWGGWSITGGATPNPGIWSYEGVAGAHIVFSGLCFLAAIWHWTYWDL AIFCDERTGKPSLDLPKIFGIHLFLAGLACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQS VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTRRQTV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | Q0G9T6 |
◆ Recombinant Proteins | ||
BMP6-41H | Recombinant Human BMP6 | +Inquiry |
MAGEA3-2837H | Recombinant Human Melanoma Antigen Family A, 3, His-tagged | +Inquiry |
HSD17B7-5074H | Recombinant Human HSD17B7 Protein, GST-tagged | +Inquiry |
NASC-0929B | Recombinant Bacillus subtilis NASC protein, His-tagged | +Inquiry |
EAEA-2088H | Recombinant Hafnia Alvei EAEA Protein (1-280 aa), His-SUMO-tagged | +Inquiry |
◆ Native Proteins | ||
LTF-8196H | Native Human Breast Milk Lactoferrin APO | +Inquiry |
pepsin -174P | Native Pig pepsin(1:3000) active | +Inquiry |
A1AGP-01P | Native Porcine A1AGP Protein | +Inquiry |
Fibrinogen-7589H | Native Human Fibrinogen | +Inquiry |
ACTN1-162C | Native chicken ACTN1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNN2-7405HCL | Recombinant Human CNN2 293 Cell Lysate | +Inquiry |
HeLa-026HCL | Human Nocodazole Stimulated HeLa Whole Cell Lysate | +Inquiry |
TULP2-639HCL | Recombinant Human TULP2 293 Cell Lysate | +Inquiry |
IRAK4-615HCL | Recombinant Human IRAK4 cell lysate | +Inquiry |
ABP1-9123HCL | Recombinant Human ABP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket