Recombinant Full Length Olimarabidopsis Pumila Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL36723OF |
Product Overview : | Recombinant Full Length Olimarabidopsis pumila Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (A4QJV7) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Olimarabidopsis pumila (Dwarf rocket) (Arabidopsis griffithiana) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWNITGGTITNPGLWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSD AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRNKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTKRQAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | A4QJV7 |
◆ Recombinant Proteins | ||
LDHA-2307R | Recombinant Rhesus Macaque LDHA Protein, His (Fc)-Avi-tagged | +Inquiry |
FPGS-12608Z | Recombinant Zebrafish FPGS | +Inquiry |
TNFRSF1A-65H | Active Recombinant Human TNFRSF1A protein, Fc-tagged | +Inquiry |
BEND7-1011M | Recombinant Mouse BEND7 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZC4H2-6148H | Recombinant Human ZC4H2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
Lectin-1755C | Active Native Canavalia ensiformis Concanavalin A Protein | +Inquiry |
AMY1A-8022H | Native Human Salivary Amylase | +Inquiry |
LDH-217R | Active Native Rabbit Lactate Dehydrogenase | +Inquiry |
IgA-240B | Native Bovine Immunoglobulin A | +Inquiry |
Cyfra-21-1-01H | Native Human MCF-7 Cell Cyfra-21-1 Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADCK4-9022HCL | Recombinant Human ADCK4 293 Cell Lysate | +Inquiry |
PHACTR4-3244HCL | Recombinant Human PHACTR4 293 Cell Lysate | +Inquiry |
Duodenum-112C | Cynomolgus monkey Duodenum Lysate | +Inquiry |
APBB1IP-29HCL | Recombinant Human APBB1IP lysate | +Inquiry |
CRKL-403HCL | Recombinant Human CRKL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket