Recombinant Full Length Pinus Thunbergii Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL28372PF |
Product Overview : | Recombinant Full Length Pinus thunbergii Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (P41624) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pinus thunbergii (Japanese black pine) (Pinus thunbergiana) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLISVHIMHTALVAGWAGSMTLYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGIKDSWSGWNITGETVINPGIWSYEGVAVAHIVFSGLCFLAAIWHWVYWDL DIFCDERTGKRCLDLPKVFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKIQP VDPAWGAEGFDPFVPGGIASHHIAAGILGILAGLFHLSVRPPQRLYVGLRMGNIETVLSS SIAAVFFAAFIVAGTMWYGSATTPVELFGPTRYQWDQGYFQQEIDRRVRAGLAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGAMDNGDGIAVGWLGHPIFKDKEGNELFVRRMP TFFETFPVVLVDKEGIVKADVPFRRAESKYSVEQVGVTVEFYGGGLDRVSFGDPAIVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHATFALLFFSGHIWHGARTLFRDVFA GIDSDLDDRIEFGAFQKLGDPTTKRQVV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | P41624 |
◆ Recombinant Proteins | ||
TREML2-3627C | Recombinant Chicken TREML2 | +Inquiry |
COPS2-796R | Recombinant Rhesus Macaque COPS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RABL6-446H | Recombinant Human RABL6 Protein, MYC/DDK-tagged | +Inquiry |
DDX56-538H | Recombinant Human DDX56 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NS1-363V | Recombinant Dengue Virus 4 NS1 + V5 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
GFAP-526H | Native Human GFAP protein | +Inquiry |
Arg1-8044R | Native Rat Liver Arginase | +Inquiry |
DNA-005C | Native Calf DNA | +Inquiry |
Lectin-1715U | Native Ulex europaeus Lectin, FITC conjugated | +Inquiry |
Lectin-1811M | Active Native Maclura Pomifera Lectin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLPSL1-7997HCL | Recombinant Human C6orf127 293 Cell Lysate | +Inquiry |
ABT1-12HCL | Recombinant Human ABT1 cell lysate | +Inquiry |
POSTN-2269MCL | Recombinant Mouse POSTN cell lysate | +Inquiry |
RPP38-555HCL | Recombinant Human RPP38 lysate | +Inquiry |
EZH1-6488HCL | Recombinant Human EZH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket