Recombinant Full Length Clostridium Thermocellum Upf0365 Protein Cthe_0858 (Cthe_0858) Protein, His-Tagged
Cat.No. : | RFL27031CF |
Product Overview : | Recombinant Full Length Clostridium thermocellum UPF0365 protein Cthe_0858 (Cthe_0858) Protein (A3DDR3) (1-329aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Clostridium thermocellum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-329) |
Form : | Lyophilized powder |
AA Sequence : | MDGIAFILIVGAILVFISLFFAIVPVGLWISAFAANVRVSIFTLIGMRLRRVVPSRVINP LIKATKAGINVSINKLEAHYLAGGNVDRVVNALIAAQRANIPLEFERAAAIDLAGRNVLE AVQMSVNPKVIETPVVAAIAKDGIELRAKARVTVRANIDRLVGGAGEQTIIARVGEGVVT TVGSATDHKQVLENPDAISKTVLSKGLDAGTAFEILSIDIADIDVGRNVGAQLQTDQAEA DKRIAQAKAEERRAMAVAREQEMKAMVQEMRAKVVEAEAEVPKALAAALREGKIGVLDYY HLQNLIADTQMRDSISKMSKHDDSSSDKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cthe_0858 |
Synonyms | floA; Cthe_0858; Flotillin-like protein FloA |
UniProt ID | A3DDR3 |
◆ Native Proteins | ||
Fibronectin-13R | Native Rat Fibronectin Protein | +Inquiry |
VTN-31736TH | Native Human VTN | +Inquiry |
RO60-18C | Native Cattle RO60 Protein | +Inquiry |
VLDL-392H | Native Human Very Low Density Lipoprotein | +Inquiry |
LTA-14S | Native S. aureus LTA Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TP53-860HCL | Recombinant Human TP53 293 Cell Lysate | +Inquiry |
SERPINC1-1725CCL | Recombinant Cynomolgus SERPINC1 cell lysate | +Inquiry |
Lung-493C | Chicken Lung Lysate, Total Protein | +Inquiry |
HCT-776H | HCT 116 (human colorectal carcinoma) whole cell lysate | +Inquiry |
Esophagus-1H | Human Esophagus Tumor Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Cthe_0858 Products
Required fields are marked with *
My Review for All Cthe_0858 Products
Required fields are marked with *
0
Inquiry Basket