Recombinant Full Length Meriones Unguiculatus Monocarboxylate Transporter 1(Slc16A1) Protein, His-Tagged

• Cat.No.: RFL15926MF
• Product Overview: Recombinant Full Length Meriones unguiculatus Monocarboxylate transporter 1(SLC16A1) Protein (O35439) (1-76aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Source: E.coli expression system
• Species: Meriones unguiculatus (Mongolian jird) (Mongolian gerbil)
• Tag: His
• Form: Lyophilized powder
• Protein length: Full Length (1-76)
• AA Sequence: LSILAFVDMVARPSMGLAANTKWIRPRIQYFFAASVVANGVCHLLAPLSTSYIGFCVYAG VFGFAFGWLSSVLFET
• Purity: Greater than 90% as determined by SDS-PAGE.
• Applications: SDS-PAGE
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: SLC16A1
• Synonyms: SLC16A1; MCT1; Monocarboxylate transporter 1; MCT 1; Solute carrier family 16 member 1; Fragment
• UniProt ID: O35439