Recombinant Full Length Clostridium Perfringens Cardiolipin Synthase(Cls) Protein, His-Tagged
Cat.No. : | RFL4171CF |
Product Overview : | Recombinant Full Length Clostridium perfringens Cardiolipin synthase(cls) Protein (Q0ST20) (1-476aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Clostridium perfringens |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-476) |
Form : | Lyophilized powder |
AA Sequence : | MHLLINIIFLINIIFIISIIFIERRNPQTTWAWILILTFLPILGFIIYILFGQNITREKN FKRKILDDKTKQKYLNSFKSHYKLDNISLKYKDLIMMNFNNDNSTYTQRNDIDLYFDANS LFQEMIYEINKAEKFIHMEFYIFKSDEIGKKILQALTKKAKEGVEVKLLVDSIGNSIHKK DIDKLKAAGGDFKIFFPGFCKYINLRINYRNHRKILIIDSKVAFLGGFNIGDEYLGKDKN IGNWRDTHTKIKGLAINDLEARFLLDWSYANESDLDIDLKKYFINPHSTNLPNNIIGAQI VSSGPDHTEQQIKNGYFKIINSAKKNLFIQTPYFVPDEPMLEALRLAALSGVDVKIMLPG NPDHKFMEWIANSYFESLLNAGVKIYLYEKGFLHAKTIVADSSICSVGTANMDIRSFSLN FESNIFIYNEAISKSMEEQFFKDLKVCTKVTLESFEKRSIISRIGESIIRLVSPLM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cls |
Synonyms | cls; CPR_1418; Cardiolipin synthase; CL synthase |
UniProt ID | Q0ST20 |
◆ Recombinant Proteins | ||
HMGXB3-2056H | Recombinant Human HMGXB3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
KPNA5-5819HF | Recombinant Full Length Human KPNA5 Protein, GST-tagged | +Inquiry |
NFKB1-105H | Recombinant Human NFKB1 | +Inquiry |
FAM101A-5444M | Recombinant Mouse FAM101A Protein | +Inquiry |
ALKBH7-2381Z | Recombinant Zebrafish ALKBH7 | +Inquiry |
◆ Native Proteins | ||
Lectin-1802L | Active Native Lycopersicon Esculentum Lectin Protein, DyLight 488 Labeled | +Inquiry |
Lectin-1724C | Native Canavalia ensiformis Lectin | +Inquiry |
TF-002H | Native Human TF Protein, Rhodamine Conjugated | +Inquiry |
LDH-216S | Active Native Porcine Lactate Dehydrogenase | +Inquiry |
S100A11-3111H | Native Human S100A11 protein(Met1-Thr105) | +Inquiry |
◆ Cell & Tissue Lysates | ||
SKIL-1814HCL | Recombinant Human SKIL 293 Cell Lysate | +Inquiry |
MGMT-1109HCL | Recombinant Human MGMT cell lysate | +Inquiry |
C9orf170-7937HCL | Recombinant Human C9orf170 293 Cell Lysate | +Inquiry |
EIF2B3-6671HCL | Recombinant Human EIF2B3 293 Cell Lysate | +Inquiry |
C20orf85-8107HCL | Recombinant Human C20orf85 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cls Products
Required fields are marked with *
My Review for All cls Products
Required fields are marked with *
0
Inquiry Basket