Recombinant Full Length Alkalilimnicola Ehrlichei Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL7215AF |
Product Overview : | Recombinant Full Length Alkalilimnicola ehrlichei Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q0A4U4) (1-589aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Alkalilimnicola ehrlichii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-589) |
Form : | Lyophilized powder |
AA Sequence : | MSKGHSDHPSAGESWHLYKRIFGFIKPYWRLGVLAIVCMVLAAAGQAAFAWIIQPLVDGT FIEQDPGARLWVPATLVGIFLFHGVTTFASDYTVAWVGRRVVKDVRQAVFEQYLRLPTSY FDKNSPGTLLAKLTYNVNQISAAASKAVVVLVRDTFTVIFLLAYMTYLSGWLVMIVFGLG PLVAVVVTAANKRFRKLSRRMQASVGEYAQIAEDGIRGQAEVKIFGGQRYEAERFDRTNT RHHRQLMRYKAVQAASQPLAQLGAVIALAIILYLATMDVILETISPGGMISFIAAMLLML PPLKRVIGVNAEIQKALAAGESVFEVLDAPPEPDHGQRPLERARGLIEFDRVAFRYPESE DWVLRDINLSIQPGETVALVGRSGSGKTTLASLLPRFYDPQRGEIRLDGHPLAEYRLQAL RSQMSLVNQQVVLFNDSLANNIAYGLSERPTAAQLQAAARAANALEFIEELPEGFDTVIG ENGVMLSGGQRQRIAIARALLKDAPILILDEATSALDSESEKRIQEALEKLMRGRTTLVI AHRLSTIEDADRIVVLDAGRVVETGTHRELLDHNGHYASLHRVQFNGPS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; Mlg_2803; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q0A4U4 |
◆ Recombinant Proteins | ||
OX40-1002R | Active Recombinant Cynomolgus/Rhesus macaque OX40 protein, Fc-tagged | +Inquiry |
hupA-28E | Recombinant E.coli hupA, His-tagged | +Inquiry |
AVIL-1042H | Recombinant Human AVIL protein, GST-tagged | +Inquiry |
RFL25387EF | Recombinant Full Length Oligopeptide Transport System Permease Protein Oppc(Oppc) Protein, His-Tagged | +Inquiry |
BAX-6975H | Recombinant Human BAX, GST-tagged | +Inquiry |
◆ Native Proteins | ||
THBS1-4946H | Native Human Thrombospondin protein | +Inquiry |
Prothrombin-271B | Active Native Bovine Prothrombin Frag 1 | +Inquiry |
CRP-5330H | Native Canine CRP protein | +Inquiry |
S100AA-258B | Native Bovine S-100αα Protein | +Inquiry |
H3N20799-215I | Native H3N2 (A/Panama/2007/99) H3N20799 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAE1-3984HCL | Recombinant Human NAE1 293 Cell Lysate | +Inquiry |
HYLS1-5321HCL | Recombinant Human HYLS1 293 Cell Lysate | +Inquiry |
ARL2BP-8715HCL | Recombinant Human ARL2BP 293 Cell Lysate | +Inquiry |
ALDH4A1-001HCL | Recombinant Human ALDH4A1 cell lysate | +Inquiry |
TMEM154-677HCL | Recombinant Human TMEM154 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket