Recombinant Full Length Caulobacter Crescentus Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL1257CF |
Product Overview : | Recombinant Full Length Caulobacter crescentus Apolipoprotein N-acyltransferase(lnt) Protein (Q9AC16) (1-530aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caulobacter crescentus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-530) |
Form : | Lyophilized powder |
AA Sequence : | MIAWTRFRERPWSGPALALIAGLAAALAHPPFGVLPGLLGYAGLLHLLDNADVQRPLRSV FWRGWLAGVGYFGLGTWWVGEAFLVDAATHGWMAPFAVTGMAAGLALFWGLAALLYRALR PASAWRVLTFAGAFAALEWMRGHVLTGFPWNLPGETWKAGSAPSQLAALVGAYGLTWITL AIAGAPAVWRQGRGGRAATGLAVASLIGLYGYGAIALSRPLSPSGPTTVRIVQADIKQDL KWDAERFAQIVQAYVSLTATPYAAKPADIVIWPEGALPAAVNDYLAPGTWVRQAIVDSLA PGQLLLIGGYRYEGAGPHPTYYNSLVALRRTETDLELVGIYDKHRLVPFGEYLPADRFLT VIGFKSLARLSDNFTTGPTPAPLRISPELLVQPLICYESLFPGLAKPDPNVRALINVSND AWFGVTSGPPQHLNLASYRAIESAKPILRATPTGISAVVDARGRIVPGASLGLGESGVID AQIPGMGQVTPYDNFGDVAFLALILISGVVSARVRIGKISSSIAPKRKLS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; CC_0052; Apolipoprotein N-acyltransferase; ALP N-acyltransferase |
UniProt ID | Q9AC16 |
◆ Recombinant Proteins | ||
GSTT2-13583H | Recombinant Human GSTT2, GST-tagged | +Inquiry |
PPWD1-5716Z | Recombinant Zebrafish PPWD1 | +Inquiry |
RFL23812XF | Recombinant Full Length Xenopus Tropicalis Calcium-Binding Mitochondrial Carrier Protein Scamc-2(Slc25A25) Protein, His-Tagged | +Inquiry |
YFLD-3236B | Recombinant Bacillus subtilis YFLD protein, His-tagged | +Inquiry |
SLC33A1-703HF | Recombinant Full Length Human SLC33A1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Spinal cord-C57M | Mouse Spinal cord whole Lysate, Total Protein | +Inquiry |
APOA2-8036H | Native Human ApoLipoprotein APOA2 | +Inquiry |
BPE-138 | Native Red algae B-Phycoerythrin protein | +Inquiry |
F2-275B | Active Native Bovine α-Thrombin-DFP | +Inquiry |
ADA-P036B | Native Bovine adenosine deaminase therapeutic protein (Pegademase bovine) | +Inquiry |
◆ Cell & Tissue Lysates | ||
SETD9-8012HCL | Recombinant Human C5orf35 293 Cell Lysate | +Inquiry |
SLC30A1-603HCL | Recombinant Human SLC30A1 lysate | +Inquiry |
SUCLA2-1367HCL | Recombinant Human SUCLA2 293 Cell Lysate | +Inquiry |
HA-003H7N9CL | Recombinant H7N9 HA cell lysate | +Inquiry |
FAM84B-6342HCL | Recombinant Human FAM84B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket