Recombinant Full Length Bdellovibrio Bacteriovorus Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL30035BF |
Product Overview : | Recombinant Full Length Bdellovibrio bacteriovorus Apolipoprotein N-acyltransferase(lnt) Protein (P61032) (1-547aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bdellovibrio bacteriovorus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-547) |
Form : | Lyophilized powder |
AA Sequence : | MDSLTLYVTNTMMKRWFQFFKHKAYDFRWAILSGILVGTSYIPFPPWALIFCYTPLWIYV TEESSSVKKSFWAGWVTQFILTLIGFHWIAYTAHEFGQLPWAVSYLALLLFCAFMHLYIP VAVAAGTWLRLRFKLSGGQTLFTIALLHALLERTWPVIFEWHLGYTLIWSKIPMYHLADL VGFHGLSAVVLLFNAWMGYVWLKQSFVKKALSHLSLLALTFAALVGWGFWHGKAWNKFDG ETKATVVQANIGNLEKIYAEQGRAYQEVITRKFLDLSFAAMQKYPQTDILIWPETAFPDY LDQHLLDRKHAQILISGLQPLSRPLITGAYSKDPKADEKQDTSTYNALFLVDPLGNNLDK PYRKTELLAFGEYLPLSEQFPFLLKLLPFVSNFGRGHGPEVMKWDTPQGSVRWGGQICYE GLYPSFTRGLAEKGADILVNVTNDSWFGKTFEPQQHLYMTLARAIEVRRPLVRSTNTGVS TAVLANGDVLQKSPLHEEWSGQFVIKYLKNAPLTFFVQWGHWDWIVILLVLGAVIGRGAL NARSRRS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; Bd1278; Apolipoprotein N-acyltransferase; ALP N-acyltransferase |
UniProt ID | P61032 |
◆ Recombinant Proteins | ||
UBE2D2A-9823M | Recombinant Mouse UBE2D2A Protein, His (Fc)-Avi-tagged | +Inquiry |
ASTN1-9948H | Recombinant Human ASTN1, His-tagged | +Inquiry |
C4orf3-129H | Recombinant Human C4orf3 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
CALCOCO2-174H | Recombinant Human calcium binding and coiled-coil domain 2 Protein, Tag Free | +Inquiry |
EIF5-8633H | Recombinant Human EIF5 protein(Met1-Asp150), GST-tagged | +Inquiry |
◆ Native Proteins | ||
NUC-0003 | Native Human Nucleosome | +Inquiry |
TF-143C | Native Chicken Serum Transferrin | +Inquiry |
PLG-30879TH | Native Human PLG | +Inquiry |
TFRC-249H | Native Human Transferrin Receptor | +Inquiry |
ORM1-110H | Native Human Alpha 1 Acid Glycoprotein (A1AGP) | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPS15A-2172HCL | Recombinant Human RPS15A 293 Cell Lysate | +Inquiry |
MED15-4392HCL | Recombinant Human MED15 293 Cell Lysate | +Inquiry |
CLEC14A-1138RCL | Recombinant Rat CLEC14A cell lysate | +Inquiry |
Spleen-476C | Cat Spleen Lysate, Total Protein | +Inquiry |
Eye-430S | Sheep Eye Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket