Recombinant Full Length Chlorophyll A/B Light-Harvesting Protein Pcba(Pcba) Protein, His-Tagged
Cat.No. : | RFL34140PF |
Product Overview : | Recombinant Full Length Chlorophyll a/b light-harvesting protein pcbA(pcbA) Protein (P95503) (2-350aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Prochlorothrix hollandica |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-350) |
Form : | Lyophilized powder |
AA Sequence : | ATTATPEYGWWAGNSRFALQSGKWLSAHIAQYALITFWAGGITLFELARYNPDVSMGEQG LILIPHLATLGWGIGSGGQVVDTYPYFVIGVIHLVASAVFGAGALYHALKGPEDLSQSDF EFAKNFHFEWDDAAKLGNILGHHLLTLGYAALLFVIWLRFHGVYDSTIGEVRVVTNPGAT ILSVLFEYGWFTPDHNPYFVNNLEDLASGHAYIAVVLLAGGFWHINQAPFPWAQRLLASL FSPEGLLSASLAGLSMAGFAAAYFSAVNTLAYPVEFFGPPLELKFSVAPYFVDTIDLPNG AHTARAWLCNVHFFLAFFVLQGHLWHALRALGFDFKRIPQALGSLSGEA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pcbA |
Synonyms | pcbA; Chlorophyll a/b light-harvesting protein PcbA |
UniProt ID | P95503 |
◆ Recombinant Proteins | ||
ABL1-096H | Active Recombinant Human ABL1 Protein, His-Tagged | +Inquiry |
Il4-243I | Active Recombinant Mouse Il4 Protein | +Inquiry |
ATPI4K-5568A | Recombinant Mouse-ear cress PI4KA1 Protein (Gly888-Thr1203), N-His tagged | +Inquiry |
PARP3-432H | Recombinant Human PARP3 Protein, MYC/DDK-tagged | +Inquiry |
Nptx2-4481M | Recombinant Mouse Nptx2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
V8Protease-01S | Active Native Staph aureus V8 Protease, Tag Free | +Inquiry |
RNASE3-5318H | Native Human Ribonuclease, RNase A Family, 3 | +Inquiry |
GPT-187H | Active Native Human Glutamate Pyruvate Transaminase | +Inquiry |
THBS-260H | Native Human Thrombospondin | +Inquiry |
CA6-804H | Native Human CA6 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPX4-308HCL | Recombinant Human GPX4 lysate | +Inquiry |
ZNF75A-2084HCL | Recombinant Human ZNF75A cell lysate | +Inquiry |
SCNN1B-2028HCL | Recombinant Human SCNN1B 293 Cell Lysate | +Inquiry |
Hippocampus Nuclear-241H | Human Hippocampus Nuclear Lysate | +Inquiry |
TUBGCP3-641HCL | Recombinant Human TUBGCP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All pcbA Products
Required fields are marked with *
My Review for All pcbA Products
Required fields are marked with *
0
Inquiry Basket