Active Recombinant Mouse Il4 Protein
Cat.No. : | Il4-243I |
Product Overview : | Recombinant Mouse Il4 Protein without tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | CHO |
Description : | Interleukin-4 (IL-4) is a pleiotropic cytokine regulates diverse T and B cell responses including cell proliferation, survival, and gene expression. It has important effects on the growth and differentiation of different immunologically competent cells. Interleukin-4 is produced by mast cells, T cells, and bone marrow stromal cells. IL-4 regulates the differentiation of native CD4+ T cells (Th0 cells) into helper Th2 cells, and regulates the immunoglobulin class switching to the IgG1 and IgE isotypes. IL-4 has numerous important biological functions including stimulating B-cells activation, T-cell proliferation and CD4+ T-cells differentiation to Th2 cells. It is a key regulator in hormone control and adaptive immunity. IL-4 also plays a major role in inflammation response and wound repair via activation of macrophage into M2 cells. IL-4 is stabilized by three disulphide bonds forming a compact globular protein structure. Four alpha-helix bundle with left-handed twist is dominated half of the protein structure with 2 overhand connections and fall into a 2-stranded anti-parallel beta sheet. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 2 ng/mL, measured in a cell proliferation assay using murine HT-2 cells, corresponding to a specific activity of >5 5 units/mg. |
Molecular Mass : | 15 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
Storage : | Lyophilized recombinant Murine Interleukin 4 (IL-4) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmIL-4 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Il4 interleukin 4 [ Mus musculus ] |
Official Symbol | Il4 |
Synonyms | IL4; interleukin 4; interleukin-4; IGG1 induction factor; B-cell growth factor 1; B-cell stimulatory factor 1; lymphocyte stimulatory factor 1; B-cell IgG differentiation factor; Il-4; BSF-1; |
Gene ID | 16189 |
mRNA Refseq | NM_021283 |
Protein Refseq | NP_067258 |
UniProt ID | P07750 |
◆ Recombinant Proteins | ||
Il4-5705M | Recombinant Mouse Il4 Protein (His21-Ser140), C-His tagged | +Inquiry |
IL4-504H | Recombinant Human IL4 protein | +Inquiry |
Il4-5181M | Active Recombinant Mouse Il4 Protein | +Inquiry |
Il4-342G | Recombinant Golden hamster Il4 protein, His&Strep II-tagged | +Inquiry |
Il4-477R | Recombinant Rat Il4 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL4-001MCL | Recombinant Mouse IL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il4 Products
Required fields are marked with *
My Review for All Il4 Products
Required fields are marked with *
0
Inquiry Basket