Recombinant Full Length Chlorobium Tepidum Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL658CF |
Product Overview : | Recombinant Full Length Chlorobium tepidum Macrolide export ATP-binding/permease protein MacB(macB) Protein (Q8KFE9) (1-651aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chlorobium tepidum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-651) |
Form : | Lyophilized powder |
AA Sequence : | MIEIVNVTKTYRIGESSVKALDGVSLTIGQGEFVAIMGASGSGKSTLMHILGLLDVPDTG QYRLMGKEVSRMSDDELAGIRNNVAGFVFQQFHLLSRMSTIDNVVLPCIYSGQRGDFRKD ALKRLEMVGLAQRSDHRPNQMSGGEQQRVAIARALIRDPMLIFADEPTGNLDTKNSHEIM RILTDLHRQGKTIIMVTHETDIAEFADRVITMKDGVVVDDRKKQDARLNPQMPQGGMEAA HSALFQPSRLLGFVVQAFQSIASNKIRTFLSVLGILVGVASVIAMMALGTGAKASMEEQL KSMGSNLLSVRGGSAKIGGASQGFGTVTRFTEKDAAAIQAIPNLIDHVSGDVTGSGQLVY LDKNWSTSVEGVDYDYGEMRAAIPTVGRWFTREEIQERAKVAILGTTVAMQLFGDADPVD KIIKINRINFRVIGVAPAKGFAGPRDQDDVVYIPVSTAMYRVLGKLYLDGIYVEVSSAEN IAPATQAIDALIRKRHKLAADDQDSFNIRDMTQFQQMLSATTQTMSMLLGSIAAISLVVG GIGIMNIMLVSVTERTREIGLRKAIGARKGDIMLQFLIESVGMTLSGGIIGIVVGVGVSV MLSAFAGWAVKTSMFSVVLATGFSVLIGLFFGLWPARKAAALKPVEALRYE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; CT0378; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | Q8KFE9 |
◆ Recombinant Proteins | ||
MRM1-10039M | Recombinant Mouse MRM1 Protein | +Inquiry |
RFL35393HF | Recombinant Full Length Human Interferon Alpha-Inducible Protein 27, Mitochondrial(Ifi27) Protein, His-Tagged | +Inquiry |
THRS-3328S | Recombinant Staphylococcus epidermidis ATCC 12228 THRS protein, His-tagged | +Inquiry |
ZNF763-3055H | Recombinant Human ZNF763 protein, His-tagged | +Inquiry |
Il1r2-5703M | Recombinant Mouse Il1r2 Protein (Phe14-Glu355), C-His tagged | +Inquiry |
◆ Native Proteins | ||
HBB-001H | Native Human Hemoglobin S, Ferrous Stabilized | +Inquiry |
LOX-41 | Active Native Lactate Oxidase | +Inquiry |
DNASE1-8333B | Native Bovine DNASE1 | +Inquiry |
PROC-269B | Active Native Bovine Protein C | +Inquiry |
BIAP-76B | Native Bovine Intestinal Alkaline Phosphatase | +Inquiry |
◆ Cell & Tissue Lysates | ||
USP19-1893HCL | Recombinant Human USP19 cell lysate | +Inquiry |
PROX1-2830HCL | Recombinant Human PROX1 293 Cell Lysate | +Inquiry |
TIMP4-1063HCL | Recombinant Human TIMP4 293 Cell Lysate | +Inquiry |
NCDN-1172HCL | Recombinant Human NCDN cell lysate | +Inquiry |
PRTFDC1-2799HCL | Recombinant Human PRTFDC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket