Recombinant Full Length Brucella Abortus Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL19480BF |
Product Overview : | Recombinant Full Length Brucella abortus Macrolide export ATP-binding/permease protein MacB(macB) Protein (Q2YRG7) (1-646aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Brucella Abortus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-646) |
Form : | Lyophilized powder |
AA Sequence : | MAGAPLIRLEDICKTFHNGDLAVEVLHGITLDIRAGEFVAIMGASGSGKSTLMNILGCLD TPTGGRYLLDGEDVSTLNADELATLRRRTFGFVFQSYNLIPTSTAQENVEVPAIYAGTPA AERRKRAAALLNALKLGDRLDHRPSQLSGGQQQRISIARALMNGGRIILADEPTGALDSQ SGEDVMELLRSMHQQGHTVIVITHAREVAERADRLIEIRDGQILSDTTKRDIHTPEATLQ PHEEIAGNGAHIADISEAVKMALHALRANIFRTVLTLLGIIIGVSSVVTMLAIGTGAQNT ILDRINAMGTDLILVRPAMAGFRGSGSIATLVPQDADAILELPNVKSAVPEVTGTVTLRR GNVDYQSQANGTVPAFSSEIVESRQRQLHHPERYRYLRPCGWLGTTVVKTLFPDGGNPVG DYILIQKIPFQIIGTLEPKGAGFGGSDQDDVVVVPLSTGNLRLFGQKYVRSITVQVKDSS LIDTTQNQIQSLLDQRHKKRDTMITNMSSVREDAAAMGKTMTVFLGSVAAISLLVGGIGV MNIMLVSVTERTREIGVRMATGARRRDILLQFIIEALSVSAIGGAIGVILGLGAAALASW AGLSVGYSFGPVLLAFACAFATGLIFGFLPARKASRLLPAVALSSE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; BAB1_1683/BAB1_1684; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | Q2YRG7 |
◆ Recombinant Proteins | ||
RGS17-647Z | Recombinant Zebrafish RGS17 | +Inquiry |
NOVA1-4469C | Recombinant Chicken NOVA1 | +Inquiry |
C1QTNF4-2460Z | Recombinant Zebrafish C1QTNF4 | +Inquiry |
KLK5-2433R | Recombinant Rhesus monkey KLK5 Protein, His-tagged | +Inquiry |
SAP019A-009-1810S | Recombinant Staphylococcus aureus (strain: NRS104) SAP019A_009 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Spinal Cord-010H | Human Spinal Cord Lysate, Total Protein | +Inquiry |
COL2A1-16C | Native Chicken COL2A1 Protein | +Inquiry |
C5-10540H | Active Native Human C5 | +Inquiry |
HB-43R | Native Rat Hemoglobin (HB) Protein | +Inquiry |
Fetuin-5263B | Native Bovine Fetuin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
VAV1-423HCL | Recombinant Human VAV1 293 Cell Lysate | +Inquiry |
PC-12-2144R | PC-12 (rat adrenal gland pheochromocytoma) whole cell lysate | +Inquiry |
ITIH1-882HCL | Recombinant Human ITIH1 cell lysate | +Inquiry |
PGAM1-3264HCL | Recombinant Human PGAM1 293 Cell Lysate | +Inquiry |
TNNI1-883HCL | Recombinant Human TNNI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket