Recombinant Full Length Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL35171EF |
Product Overview : | Recombinant Full Length Macrolide export ATP-binding/permease protein MacB(macB) Protein (P0C2H2) (1-646aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-646) |
Form : | Lyophilized powder |
AA Sequence : | MKKLIELKGVSRTYGNGDQTRTVLKNVDLTIVAGEMVAIIGASGSGKSTLMNIMGCLDVP NRGDYYIDGQNAACLSPDELARVRREHIGFIFQRYHLIPDLSALGNVEIPAIYANSERDS RRQRATALLGRLGLEGREHHKPCELSGGQQQRVSIARALINGGKIILADEPTGALDSQSG QEVLAILNELNRRGHTVVMVTHDMKVARHAKRIIELCDGEIIADSGGCVSATETLPKTNR IRQSYWKTLLDRTRESMQMALKAMKTHRLRTTLTMIGIVFGIASVVTVVALGEGARQETL EEIKSLGTNVVSIYPGQDLFDDSIESIRTLVPADANALAKQGFIDSVSPEVSASDNIRFL GKSAIASINGVGREHFRVKGIELLQGTTFRDDRNALQEVIIDENTRKAIFDNTGLQALGQ IVFLGSVPARVVGIAKSNNRSDASNRITVWMPYSTVMYRIVGKPVLTGISVRLKDNVDNE AAISAISQLLTRRHGIKDFQLYNFEQIRKSIEHTSMTFSILILMVACISLMIGSIGVMNI MLISVTERTHEIGVRMAVGARRSDIMQQFIIEAVLVCLIGGALGIALSYITGALFNALAD GIFAAIYSWQAAVAAFFCSTLIGIIFGYLPARKAARMDPVISLASE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; etsB; O2ColV34; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | P0C2H2 |
◆ Recombinant Proteins | ||
PDCD5-2528H | Recombinant Human PDCD5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NKX1.2LA-12096Z | Recombinant Zebrafish NKX1.2LA | +Inquiry |
RFL31621RF | Recombinant Full Length Rat Presqualene Diphosphate Phosphatase(Ppapdc2) Protein, His-Tagged | +Inquiry |
SAOUHSC-00564-3661S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 SAOUHSC_00564 protein, His-tagged | +Inquiry |
PLEKHA1-1775H | Recombinant Human PLEKHA1, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1811M | Active Native Maclura Pomifera Lectin Protein, Fluorescein labeled | +Inquiry |
Lectin-1735P | Active Native Peanut Agglutinin Protein, Rhodamine labeled | +Inquiry |
a-Thrombin-97H | Native Human a-Thrombin | +Inquiry |
F10-267B | Active Native Bovine Factor X | +Inquiry |
TF-48P | Native Pig Transferrin (TRF) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPRN-1496HCL | Recombinant Human SPRN 293 Cell Lysate | +Inquiry |
UBP1-547HCL | Recombinant Human UBP1 293 Cell Lysate | +Inquiry |
RELA-2423HCL | Recombinant Human RELA 293 Cell Lysate | +Inquiry |
ZMAT5-155HCL | Recombinant Human ZMAT5 293 Cell Lysate | +Inquiry |
RAC3-2566HCL | Recombinant Human RAC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket