Recombinant Full Length Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL4827EF |
Product Overview : | Recombinant Full Length Macrolide export ATP-binding/permease protein MacB(macB) Protein (Q8XED0) (1-648aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-648) |
Form : | Lyophilized powder |
AA Sequence : | MTPLLELKDIRRSYPAGDEQVEVLKGITLDIYAGEMVAIVGASGSGKSTLMNILGCLDKA TSGTYRVAGQDVATLDADALAQLRREHFGFIFQRYHLLSHLTAEQNVEVPAVYAGLERKQ RLLRAQELLQRLGLEDRTEYYPAQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSC EQVMAILHQLRDRGHTVIIVTHDPQVAAQAERVIEIRDGEIVRNPPAIEKVNVAGGTEPV VNTASGWRQFVSGFNEALTMAWRALAANKMRTLLTMLGIIIGIASVVSIVVVGDAAKQMV LADIRSIGTNTIDVYPGKDFGDDDPQYQQALKYDDLIAIQKQPWVASATPAVSQNLRLRY NNVDVAASANGVSGDYFNVYGMTFSEGNTFNQEQLNGRAQVVVLDSNTRRQLFPHKADVV GEVILVGNMPARVIGVAEEKQSMFGSSKVLRVWLPYSTMSGRVMGQSWLNSITVRVKEGF DSAEAEQQLTRLLSLRHGKKDFFTWNMDGVLKTVEKTTRTLQLFMTLVAVISLVVGGIGV MNIMLVSVTERTREIGIRMAVGARASDVLQQFLIEAVLVCLVGGALGITLSLLIAFTLQL FLPGWEIGFSPLALLLAFLCSTVTGILFGWLPARNAARLDPVDALARE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; Z1116; ECs0965; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | Q8XED0 |
◆ Recombinant Proteins | ||
RFL22365BF | Recombinant Full Length Burkholderia Mallei Nadh-Quinone Oxidoreductase Subunit A(Nuoa) Protein, His-Tagged | +Inquiry |
KCNAB2-3170R | Recombinant Rat KCNAB2 Protein | +Inquiry |
OPTN-3171R | Recombinant Rhesus monkey OPTN Protein, His-tagged | +Inquiry |
PPP1R21-2091C | Recombinant Chicken PPP1R21 | +Inquiry |
CG-3-2789S | Recombinant Soybean CG-3 protein, His&Myc-tagged | +Inquiry |
◆ Native Proteins | ||
ACTA1-157R | Native Rabbit skeletal muscle alpha Actin | +Inquiry |
Immunoglobulin M-85H | Native Human Immunoglobulin M | +Inquiry |
Hp-134M | Native Mouse Haptoglobin | +Inquiry |
Collagen-59C | Native Chicken Collagen Type II | +Inquiry |
HSV2-16 | Native Herpes Simplex Virus (HSV) Type 2 Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
C2orf50-8074HCL | Recombinant Human C2orf50 293 Cell Lysate | +Inquiry |
UNC45B-1886HCL | Recombinant Human UNC45B cell lysate | +Inquiry |
THEM5-1097HCL | Recombinant Human THEM5 293 Cell Lysate | +Inquiry |
IL12B-1197RCL | Recombinant Rat IL12B cell lysate | +Inquiry |
ACYP2-9041HCL | Recombinant Human ACYP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket