Recombinant Full Length Campylobacter Fetus Subsp. Fetus Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL29683CF |
Product Overview : | Recombinant Full Length Campylobacter fetus subsp. fetus Macrolide export ATP-binding/permease protein MacB(macB) Protein (A0RP01) (1-641aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Campylobacter fetus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-641) |
Form : | Lyophilized powder |
AA Sequence : | MIKLENIKKSFITGGVSSEVLKGINLEIKKGEFVAIIGQSGSGKSTLMNILGCLDTPTSG KYLLDSLDISKFKKDELSNLRLKKFGFIFQRYNLLSSNDTKSNVALPGIYAGMSKADRIN RAKDILVKLGLETKFDTMPNHLSGGQQQRVSIARALMNGGEILLCDEPTGALDSSSGVMV MQILDSLHKDGHTIIVVTHDKDIAAWADRIIEIKDGNIISDTRKNSQIYELKQNLKEIKP SLKAIRDQFFESFVMSLGAIKSHKLRSFLTMLGIIIGIASVICVVALAKGSQQKILSDIN NMGTNTITIFPGKGFGDMHSGRVRSLSIDDSNLLGKLDFVDFSTPRMNTSGLLTYANQSF SGSLRSGSEYSLAISGLKIEKGRDFTKDDIINSRSNIIIDQFTKDAFFKDVDPIGKVILF NKQPFTIVGLVKRDETSFSGDNLTVYAPYTTTMNKLTGDRDIRSIMLKLKDGVNAQVAEQ SIIEVLKIRRGSKDFFTRNSDTIRQTIESTMNTMSLLISGIALISLMVGGIGVMNIMLVS VFERTKEIGIRMAIGAKSKDIMTQFLIEAILLCAIGGSIGIGLAYAIGYGFNVFGGDFKM IFSTASIFIALGVSSLIGIVFGYIPARNASKLNPIDALLRE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; CFF8240_0759; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | A0RP01 |
◆ Native Proteins | ||
Compound E-12 | Compound E, Antibotics Free | +Inquiry |
LDL-407H | Native Human Low Density Lipoprotein, Acetylated, DiI labeled | +Inquiry |
GGT1-8131H | Native Human Liver Gamma Glutamyl Transpeptidase | +Inquiry |
TPO-702H | Native Human Thyroid Peroxidase | +Inquiry |
ACTA1-854P | Native Porcine ACTA1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SEC13-2000HCL | Recombinant Human SEC13 293 Cell Lysate | +Inquiry |
MRPS24-4142HCL | Recombinant Human MRPS24 293 Cell Lysate | +Inquiry |
NINJ2-1196HCL | Recombinant Human NINJ2 cell lysate | +Inquiry |
ZNF77-12HCL | Recombinant Human ZNF77 293 Cell Lysate | +Inquiry |
MCF-7-18H | Hydrogen Peroxide Stimulated MCF-7 Whole Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket