Recombinant Full Length Chlamydomonas Reinhardtii Cytochrome C Biogenesis Protein Ccs1, Chloroplastic(Ccs1) Protein, His-Tagged
Cat.No. : | RFL23580CF |
Product Overview : | Recombinant Full Length Chlamydomonas reinhardtii Cytochrome c biogenesis protein CCS1, chloroplastic(CCS1) Protein (Q8GTZ9) (93-613aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chlamydomonas reinhardtii (Chlamydomonas smithii) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (93-613) |
Form : | Lyophilized powder |
AA Sequence : | GGGVASPRTLVQSNAVQVAWRRLMKELSSLPRAIAIMALIAVLSGLGTFIPQNKSIEYYL VNYPDGAEKVLGFLTGDLILTLQLDHIYTADYFYLSMGLLAASLAACTYTRQWPAVKVAQ RWRFLTQPKSLLKQGRTEVLPNARVSDLGAILLQRGYQVFVKDGSLYGFKGLAGKLGPIG VHAALLLCLFGTAWSGFGTLKGNVMCPEGQDFQVASFLQPSSPIASMPASASNVIHVNKF TIDYRPDGSVAQFYSDLSLLDPAQGGKEMMRKTISVNDPFRFNGVTMYQTDWSLSAVTLR VLGQDAPLARAAQAAEAQAAASTSGPTSSASSTSDALPQQRTAFNLPMASLEGKPGVAGR LWATFLPLAEPGQDGSAPKGISILARDPQSVVFYDAKGQFVGVRRPGSGKPIEVEGLALV VEDVTGATGLELKSDPGVPAVYAGFGGLMVTTLISYLSHSQVWALQQGSSLFVSGRTNRA KLAFDRELDDILNAVPELPPTAATTVASSASTAAPAPTAKQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CCS1 |
Synonyms | CCS1; CHLREDRAFT_111044; CHLREDRAFT_195343; Cytochrome c biogenesis protein CCS1, chloroplastic; C-type cytochrome synthesis protein 1 |
UniProt ID | Q8GTZ9 |
◆ Native Proteins | ||
CTSS-27405TH | Native Human CTSS | +Inquiry |
IgG2-230H | Native Human Immunoglobulin G2 (IgG2) | +Inquiry |
F2-5286R | Native Rat Coagulation Factor II | +Inquiry |
Lectin-1753A | Active Native Aleuria Aurantia Lectin Protein, Fluorescein labeled | +Inquiry |
RBP4-247H | Native Human Retinol Binding Protein 4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARHGAP31-8738HCL | Recombinant Human ARHGAP31 293 Cell Lysate | +Inquiry |
VASH1-428HCL | Recombinant Human VASH1 293 Cell Lysate | +Inquiry |
NRG1-1592HCL | Recombinant Human NRG1 cell lysate | +Inquiry |
HDAC2-5605HCL | Recombinant Human HDAC2 293 Cell Lysate | +Inquiry |
PALLD-469HCL | Recombinant Human PALLD lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCS1 Products
Required fields are marked with *
My Review for All CCS1 Products
Required fields are marked with *
0
Inquiry Basket