Recombinant Human MYC protein, His-GST-tagged

Cat.No. : MYC-3258H
Product Overview : Recombinant Human MYC protein(P01106)(169-439aa), fused to N-terminal His tag and GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST&His
Protein Length : 169-439aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 61.7 kDa
AA Sequence : SVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name MYC v-myc myelocytomatosis viral oncogene homolog (avian) [ Homo sapiens ]
Official Symbol MYC
Synonyms MYC; v-myc myelocytomatosis viral oncogene homolog (avian); v myc avian myelocytomatosis viral oncogene homolog; myc proto-oncogene protein; bHLHe39; c Myc; proto-oncogene c-Myc; transcription factor p64; class E basic helix-loop-helix protein 39; avian myelocytomatosis viral oncogene homolog; v-myc avian myelocytomatosis viral oncogene homolog; myc-related translation/localization regulatory factor; MRTL; c-Myc;
Gene ID 4609
mRNA Refseq NM_002467
Protein Refseq NP_002458
MIM 190080
UniProt ID P01106

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MYC Products

Required fields are marked with *

My Review for All MYC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon