Recombinant Human IFNG, StrepII-tagged
Cat.No. : | IFNG-257H |
Product Overview : | Purified, full-length human recombinant IFNG or Interferon gamma protein (amino acids 24-161, 138 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 16.2 kDa. (Accession NP_000610.2; UniProt P01579) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 24-161, 138 a.a. |
Description : | IFNG is produced by lymphocytes activated by specific antigens or mitogens. In addition to having antiviral activity, it has important immunoregulatory functions. It is a potent activator of macrophages, has antiproliferative effects on transformed cells, and can potentiate the antiviral and antitumor effects of the type I interferons. It belongs to the type II (or gamma) interferon family. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
AA Sequence : | QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLT NYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ |
Endotoxin : | <0.1 eu per ug protein by lal |
Purity : | >80% pure by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. |
Gene Name | IFNG interferon, gamma [ Homo sapiens ] |
Official Symbol | IFNG |
Synonyms | IFNG; interferon, gamma; interferon gamma; IFN-gamma; immune interferon; IFG; IFI; |
Gene ID | 3458 |
mRNA Refseq | NM_000619 |
Protein Refseq | NP_000610 |
MIM | 147570 |
UniProt ID | P01579 |
Chromosome Location | 12q14 |
Pathway | ATF-2 transcription factor network, organism-specific biosystem; African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; |
Function | cytokine activity; interferon-gamma receptor binding; |
◆ Recombinant Proteins | ||
Ifng-6732M | Recombinant Mouse Ifng Protein (His23-Cys155) | +Inquiry |
Ifng-11M | Active Recombinant Mouse Ifng | +Inquiry |
IFNG-61B | Active Recombinant Bovine Interferon, Gamma | +Inquiry |
IFNG-8665H | Recombinant Human IFNG protein, hFc-Flag-tagged | +Inquiry |
IFNG-2653R | Recombinant Rat IFNG Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNG-1797MCL | Recombinant Mouse IFNG cell lysate | +Inquiry |
IFNG-001HCL | Recombinant Human IFNG cell lysate | +Inquiry |
IFNG-1007FCL | Recombinant Ferret IFNG cell lysate | +Inquiry |
IFNG-1536RCL | Recombinant Rat IFNG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFNG Products
Required fields are marked with *
My Review for All IFNG Products
Required fields are marked with *
0
Inquiry Basket