Description :	This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. Mice deficient in this gene have increased susceptibility to viral, bacterial and parasitic infections and to several autoimmune diseases.
Source :	E. coli
Species :	Mouse
Bio-activity :	Determined by its ability to inhibit the proliferation of murine WEHI-279 cells. The expected ED50 is less than or equal to 0.2 ng/ml, corresponding to a specific activity of > 5 x 10^6 units/mg.
Molecular Mass :	15.6 kDa
AA Sequence :	MHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC
Endotoxin :	Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity :	>95%, as determined by SDS-PAGE and Coomassie blue staining
Stability :	Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage :	Store at -80 centigrade.
Storage Buffer :	Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution :	Resuspend the protein in the desired concentration in proper buffer.

Gene Name	Ifng interferon gamma [ Mus musculus (house mouse) ]
Official Symbol	Ifng
Synonyms	Ifng; interferon gamma; Ifg; IFN-g; interferon gamma; IFN-gamma; gamma interferon
Gene ID	15978
mRNA Refseq	NM_008337
Protein Refseq	NP_032363
UniProt ID	P01580