Recombinant Full Length Burkholderia Thailandensis Secretion Apparatus Protein Bsaz(Bsaz) Protein, His-Tagged
Cat.No. : | RFL10407BF |
Product Overview : | Recombinant Full Length Burkholderia thailandensis Secretion apparatus protein BsaZ(bsaZ) Protein (Q2T713) (1-381aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Burkholderia thailandensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-381) |
Form : | Lyophilized powder |
AA Sequence : | MAEKTEKPTAKKLRDAAKKGQTFKARDIVALVVIATGALSAPALVDLTRVAAEFTRIAST GAQPNPGAYALAWAKLFLRIAAPFVLLCAAVGALPSLVQSRFTLAVESIRFDLTALDPVK GMKRLFSWRSVKDAVKALLYVGVFAITVRVFADLYHHDVFGLFRARPALLGHMWIVLTVR LVLLFLLCALPVLIVDAAVEYFLYHRELKMDKHEVKQEYKESEGNHEIKSKRREIHQELL SEEIKANVEQSDFIVANPTHIAIGIYVNPDIVPIPFVSVRETNARALAVIRHAEACGVPV VRNVALARSIYRNSPRRYSFVNQDDIDGVMRVLIWLKEVEAANRGGPPREMPPEATHAPD AHGGDAASGGATSAQAGERNA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | bsaZ |
Synonyms | bsaZ; BTH_II0839; Secretion apparatus protein BsaZ |
UniProt ID | Q2T713 |
◆ Native Proteins | ||
PIP-20H | Native Human PIP Protein (118 aa) | +Inquiry |
ApoA4-68H | Native Human Apolipoprotein AIV | +Inquiry |
IgG-152R | Native Rat IgG Fab fragment | +Inquiry |
B2M-8046H | Native Human Beta 2 MicroGlobulin | +Inquiry |
LDL-406H | Native Human Low Density Lipoprotein, Acetylated, Biotin labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
MED8-4378HCL | Recombinant Human MED8 293 Cell Lysate | +Inquiry |
XCL1-001CCL | Recombinant Canine XCL1 cell lysate | +Inquiry |
DEPDC6-6973HCL | Recombinant Human DEPDC6 293 Cell Lysate | +Inquiry |
Thalamus-517H | Human Thalamus (Alzheimers Disease) Lysate | +Inquiry |
HDAC5-5604HCL | Recombinant Human HDAC5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All bsaZ Products
Required fields are marked with *
My Review for All bsaZ Products
Required fields are marked with *
0
Inquiry Basket