Recombinant Full Length Burkholderia Mallei Secretion Apparatus Protein Bsaz(Bsaz) Protein, His-Tagged
Cat.No. : | RFL457BF |
Product Overview : | Recombinant Full Length Burkholderia mallei Secretion apparatus protein BsaZ(bsaZ) Protein (Q62B05) (1-411aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Burkholderia Mallei |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-411) |
Form : | Lyophilized powder |
AA Sequence : | MAEKTEKPTAKKLRDAAKKGQTFKARDIVALIVIATGALAAPALVDLTRIAAEFVRIAST GAQSNPGAYAFAWAKLFLRIAAPFVLLCAAAGALPSLVQSRFTLAVESIRFDLTALDPVK GMKRLFSWRSAKDAVKALLYVGVFALTVRVFADLYHADVFGLFRARPALLGHMWIVLTVR LVLLFLLCALPVLILDAAVEYFLYHRELKMDKHEVKQEYKESEGNHEIKSKRREIHQELL SEEIKANVEQSDFIVANPTHIAIGVYVNPDIVPIPFVSVRETNARALAVIRHAEACGVPV VRNVALARSIYRNSPRRYSFVSHDDIDGVMRVLIWLGEVEAANRGGPPPETRAPTSAEPQ ARDGVAPLGDACADNAFPDDAPPGAAAPNAGSPDSPAPDGGAPARTGDQNA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | bsaZ |
Synonyms | bsaZ; BMAA1533; Secretion apparatus protein BsaZ |
UniProt ID | Q62B05 |
◆ Recombinant Proteins | ||
Il10-214M | Active Recombinant Mouse Il10 protein | +Inquiry |
TMEM211-9354M | Recombinant Mouse TMEM211 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD160-453H | Active Recombinant Human CD160 Protein, His-tagged | +Inquiry |
Cd63-2669M | Recombinant Mouse Cd63 protein, His-tagged | +Inquiry |
MLST8-5589M | Recombinant Mouse MLST8 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
CFI-105H | Active Native Human Factor I | +Inquiry |
NEFL-181B | Native bovine NEFL | +Inquiry |
MMP9-38H | Native Human MMP-9 | +Inquiry |
ELANE-27537TH | Native Human ELANE | +Inquiry |
MB-02B | Native Bovine MB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TFG-1124HCL | Recombinant Human TFG 293 Cell Lysate | +Inquiry |
HCFC1R1-5614HCL | Recombinant Human HCFC1R1 293 Cell Lysate | +Inquiry |
OSGEPL1-1261HCL | Recombinant Human OSGEPL1 cell lysate | +Inquiry |
Liver-784D | Dog Liver Membrane Lysate, Total Protein | +Inquiry |
SV-T2-050WCY | Mouse BALB/3T3 embryo fibroblast cell, SV40 transformed, clone A31 SV-T2 Whole Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All bsaZ Products
Required fields are marked with *
My Review for All bsaZ Products
Required fields are marked with *
0
Inquiry Basket