Recombinant Full Length Burkholderia Pseudomallei Secretion Apparatus Protein Bsaz(Bsaz) Protein, His-Tagged
Cat.No. : | RFL10193BF |
Product Overview : | Recombinant Full Length Burkholderia pseudomallei Secretion apparatus protein BsaZ(bsaZ) Protein (Q63K32) (1-411aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Burkholderia pseudomallei |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-411) |
Form : | Lyophilized powder |
AA Sequence : | MAEKTEKPTAKKLRDAAKKGQTFKARDIVALIVIATGALAAPALVDLTRIAAEFVRIAST GAQPNPGAYAFAWAKLFLRIAAPFVLLCAAAGALPSLVQSRFTLAVESIRFDLTALDPVK GMKRLFSWRSAKDAVKALLYVGVFALTVRVFADLYHADVFGLFRARPALLGHMWIVLTVR LVLLFLLCALPVLILDAAVEYFLYHRELKMDKHEVKQEYKESEGNHEIKSKRREIHQELL SEEIKANVEQSDFIVANPTHIAIGVYVNPDIVPIPFVSVRETNARALAVIRHAEACGVPV VRNVALARSIYRNSPRRYSFVSHDDIDGVMRVLIWLGEVEAANRGGPPPETRAPTSAEPQ ARDGVAPPGDACADNAFPDDAPPGAAAPNAGSPDGPAPDGGAPARTGDQNA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | bsaZ |
Synonyms | bsaZ; BPSS1534; Secretion apparatus protein BsaZ |
UniProt ID | Q63K32 |
◆ Recombinant Proteins | ||
PIWIL2-3262R | Recombinant Rhesus Macaque PIWIL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Erbb4-8720RAF555 | Recombinant Rat Erbb4 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
PDGFRA-6767M | Recombinant Mouse PDGFRA Protein (Leu25-Glu524), C-His tagged | +Inquiry |
MYF6-2447C | Recombinant Chicken MYF6 | +Inquiry |
TUBB-1899H | Recombinant Human TUBB protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
Prethrombin-2-304R | Native Rat Prethrombin-2 | +Inquiry |
F13A1-5399H | Native Human Coagulation Factor XIII, A1 Polypeptide | +Inquiry |
V8Protease-01S | Active Native Staph aureus V8 Protease, Tag Free | +Inquiry |
CA19-9-01H | Active Native Human CA19-9 protein | +Inquiry |
IgE-205H | Active Native Human Immunoglobulin E | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDC-724HCL | Recombinant Human DDC cell lysate | +Inquiry |
Peripheral Blood Leukocyte-382H | Human Peripheral Blood Leukocyte Membrane Lysate | +Inquiry |
GABRG2-6057HCL | Recombinant Human GABRG2 293 Cell Lysate | +Inquiry |
MAGEA2B-4554HCL | Recombinant Human MAGEA2B 293 Cell Lysate | +Inquiry |
EFNA5-2734HCL | Recombinant Human EFNA5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All bsaZ Products
Required fields are marked with *
My Review for All bsaZ Products
Required fields are marked with *
0
Inquiry Basket