Recombinant Full Length Burkholderia Pseudomallei Secretion Apparatus Protein Bsaz(Bsaz) Protein, His-Tagged
Cat.No. : | RFL12004BF |
Product Overview : | Recombinant Full Length Burkholderia pseudomallei Secretion apparatus protein BsaZ(bsaZ) Protein (Q3JL20) (1-411aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Burkholderia pseudomallei |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-411) |
Form : | Lyophilized powder |
AA Sequence : | MAEKTEKPTAKKLRDAAKKGQTFKARDIVALIVIATGALAAPALVDLTRIAAEFVRIAST GAQPNPGAYAFAWAKLFLRIAAPFVLLCAAAGALPSLVQSRFTLAVESIRFDLTALDPVK GMKRLFSWRSAKDAVKALLYVGVFALTVRVFAGLYHADVFGLFRARPALLGHMWIVLTVR LVLLFLLCALPVLILDAAVEYFLYHRELKMDKHEVKQEYKESEGNHEIKSKRREIHQELL SEEIKANVEQSDFIVANPTHIAIGVYVNPDIVPIPFVSVRETNARALAVIRHAEACGVPV VRNVALARSIYRNSPRRYSFVSHDDIDGVMRVLIWLGEVEAANRGGPPPETRALTSAEPQ ARDGVAPPGDACADNAFPDDAPPGAAAPNAGSPDGPAPDGGAPARTGDQNA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | bsaZ |
Synonyms | bsaZ; BURPS1710b_A0573; Secretion apparatus protein BsaZ |
UniProt ID | Q3JL20 |
◆ Native Proteins | ||
Type II Collagen-01C | Native Chicken Type II Collagen | +Inquiry |
Lectin-1746M | Active Native Maackia Amurensis Lectin I Protein | +Inquiry |
HBA1-5284H | Native Human Hemoglobin, Alpha 1 | +Inquiry |
CFP-106H | Active Native Human Complement Factor P (Properdin) | +Inquiry |
CKB-46M | Native Mouse Creatine Kinase, Brain (CKB) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRNP-001HCL | Recombinant Human PRNP cell lysate | +Inquiry |
RNF19B-546HCL | Recombinant Human RNF19B lysate | +Inquiry |
HNRNPA1-5452HCL | Recombinant Human HNRNPA1 293 Cell Lysate | +Inquiry |
TIPIN-1059HCL | Recombinant Human TIPIN 293 Cell Lysate | +Inquiry |
RAP2C-2523HCL | Recombinant Human RAP2C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All bsaZ Products
Required fields are marked with *
My Review for All bsaZ Products
Required fields are marked with *
0
Inquiry Basket