Recombinant Full Length Burkholderia Pseudomallei Secretion Apparatus Protein Bsaz(Bsaz) Protein, His-Tagged
Cat.No. : | RFL4708BF |
Product Overview : | Recombinant Full Length Burkholderia pseudomallei Secretion apparatus protein BsaZ(bsaZ) Protein (A3NLD7) (1-406aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Burkholderia pseudomallei |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-406) |
Form : | Lyophilized powder |
AA Sequence : | MAEKTEKPTAKKLRDAAKKGQTFKARDIVALIVIATGALAAPALVDLTRIAAEFVRIAST GAQPNPGAYAFAWAKLFLRIAAPFVLLCAAAGALPSLVQSRFTLAVESIRFDLTALDPVK GMKRLFSWRSAKDAVKALLYVGVFALTVRVFAGLYHADVFGLFRARPALLGHMWIVLTVR LVLLFLLCALPVLILDAAVEYFLYHRELKMDKHEVKQEYKESEGNHEIKSKRREIHQELL SEEIKANVEQSDFIVANPTHIAIGVYVNPDIVPIPFVSVRETNARALAVIRHAEACGVPV VRNVALARSIYRNSPRRYSFVSHDDIDGVMRVLIWLGEVEAANRGGPPPETRAPTSAEPQ ARDGVAPPGDACADNAFPDDAPPGAAAPNAGSPDGGAPARTGDQNA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | bsaZ |
Synonyms | bsaZ; BURPS668_A2164; Secretion apparatus protein BsaZ |
UniProt ID | A3NLD7 |
◆ Native Proteins | ||
IgA-238R | Native Rabbit Immunoglobulin A | +Inquiry |
V8Protease-01S | Active Native Staph aureus V8 Protease, Tag Free | +Inquiry |
LDL-185H | Native Human Low Density Lipoprotein, acetylated, DiI | +Inquiry |
IgG-350R | Native RAT Gamma Globulin Fraction | +Inquiry |
ctxA-145V | Native Cholera Toxin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
Adipose-503D | Dog Adipose Tissue Lysate, Total Protein | +Inquiry |
ZNF697-2078HCL | Recombinant Human ZNF697 cell lysate | +Inquiry |
NA-003H9N2CL | Recombinant H9N2 NA cell lysate | +Inquiry |
SEMA5A-1310MCL | Recombinant Mouse SEMA5A cell lysate | +Inquiry |
Pancreas-648B | Bovine Pancreas Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All bsaZ Products
Required fields are marked with *
My Review for All bsaZ Products
Required fields are marked with *
0
Inquiry Basket